Förfarande : 2018/2046(BUD)
Dokumentgång i plenum
Dokumentgång : A8-0313/2018

Ingivna texter :

A8-0313/2018

Debatter :

PV 22/10/2018 - 14
CRE 22/10/2018 - 14

Omröstningar :

PV 24/10/2018 - 11.5
Röstförklaringar

Antagna texter :

P8_TA(2018)0404

BETÄNKANDE     
PDF 1022kWORD 199k
11.10.2018
PE 626.971v02-00 A8-0313/2018(Del 1)

om rådets ståndpunkt om förslaget till Europeiska unionens allmänna budget för budgetåret 2019

(11737/2018 – C8‑0410/2018 – 2018/2046(BUD))

Del 1: Förslag till resolution

Budgetutskottet

Föredragande: Daniele Viotti (avsnitt III – kommissionen)

Paul Rübig (övriga avsnitt)

FÖRSLAG TILL EUROPAPARLAMENTETS RESOLUTION
 YTTRANDE från utskottet för utrikesfrågor
 YTTRANDE från utskottet för utveckling
 YTTRANDE från utskottet för internationell handel
 YTTRANDE från budgetkontrollutskottet
 YTTRANDE från utskottet för ekonomi och valutafrågor
 YTTRANDE från utskottet för sysselsättning och sociala frågor
 YTTRANDE från utskottet för miljö, folkhälsa och livsmedelssäkerhet
 YTTRANDE från utskottet för industrifrågor, forskning och energi
 YTTRANDE från utskottet för den inre marknaden och konsumentskydd
 YTTRANDE från utskottet för transport och turism
 YTTRANDE från utskottet för regional utveckling
 YTTRANDE från utskottet för jordbruk och landsbygdens utveckling
 YTTRANDE från fiskeriutskottet
 YTTRANDE från utskottet för kultur och utbildning
 YTTRANDE från utskottet för medborgerliga fri- och rättigheter samt rättsliga och inrikes frågor
 YTTRANDE från utskottet för konstitutionella frågor
 YTTRANDE från utskottet för kvinnors rättigheter och jämställdhet mellan kvinnor och män
 INFORMATION OM ANTAGANDET I DET ANSVARIGA UTSKOTTET
 SLUTOMRÖSTNING MED NAMNUPPROP I DET ANSVARIGA UTSKOTTET

FÖRSLAG TILL EUROPAPARLAMENTETS RESOLUTION

om rådets ståndpunkt om förslaget till Europeiska unionens allmänna budget för budgetåret 2019 (11737/2018 – C8‑0410/2018 – 2018/2046(BUD))

Europaparlamentet utfärdar denna resolution

–  med beaktande av artikel 314 i fördraget om Europeiska unionens funktionssätt,

–  med beaktande av artikel 106a i fördraget om upprättandet av Europeiska atomenergigemenskapen,

–  med beaktande av rådets beslut 2014/335/EU, Euratom av den 26 maj 2014 om systemet för Europeiska unionens egna medel(1),

–  med beaktande av Europaparlamentets och rådets förordning (EU, Euratom) nr 966/2012 av den 25 oktober 2012 om finansiella regler för unionens allmänna budget och om upphävande av rådets förordning (EG, Euratom) nr 1605/2002(2),

–  med beaktande av Europaparlamentets och rådets förordning (EU, Euratom) 2018/1046 av den 18 juli 2018 om finansiella regler för unionens allmänna budget, om ändring av förordningarna (EU) nr 1296/2013, (EU) nr 1301/2013, (EU) nr 1303/2013, (EU) nr 1304/2013, (EU) nr 1309/2013, (EU) nr 1316/2013, (EU) nr 223/2014, (EU) nr 283/2014 och beslut nr 541/2014/EU samt om upphävande av förordning (EU, Euratom) nr 966/2012(3),

–  med beaktande av rådets förordning (EU, Euratom) nr 1311/2013 av den 2 december 2013 om den fleråriga budgetramen för 2014–2020(4),

–  med beaktande av det interinstitutionella avtalet av den 2 december 2013 mellan Europaparlamentet, rådet och kommissionen om budgetdisciplin, samarbete i budgetfrågor och sund ekonomisk förvaltning(5),

–  med beaktande av sin resolution av den 15 mars 2018 om de allmänna riktlinjerna för utarbetandet av budgeten(6),

–  med beaktande av sin resolution av den 19 april 2018 om beräkning av Europaparlamentets inkomster och utgifter för budgetåret 2019(7),

–  med beaktande av det förslag till Europeiska unionens allmänna budget för budgetåret 2019 som kommissionen antog den 21 juni 2018 (COM(2018)0600),

–  med beaktande av den ståndpunkt om förslaget till Europeiska unionens allmänna budget för budgetåret 2019 som rådet antog den 4 september 2018 och översände till Europaparlamentet den 13 september 2018 (11737/2018 – C8‑0410/2018),

–  med beaktande av sin resolution av den 5 juli 2018 om mandatet för trepartsmötet om förslaget till budget för 2019(8),

–  med beaktande av artikel 88 i arbetsordningen,

–  med beaktande av betänkandet från budgetutskottet och yttrandena från övriga berörda utskott (A8-0313/2018).

Avsnitt III

Översikt

1.  Europaparlamentet betonar att parlamentets behandling av 2019 års budget till fullo återspeglar de politiska prioriteringar som antogs av en överväldigande majoritet i parlamentets ovannämnda resolutioner av den 15 mars 2018 om de allmänna riktlinjerna och av den 5 juli 2018 om mandatet för trepartsmötet. Parlamentet påminner om att det centrala i dessa prioriteringar är följande: hållbar tillväxt, innovation, konkurrenskraft, säkerhet, åtgärder för att ta itu med de grundläggande orsakerna till flykting- och migrationsströmmar, hantering av flykting- och migrationsströmmar, kampen mot klimatförändringar och övergången till hållbar energi, och ett särskilt fokus på ungdomar.

2.  Europaparlamentet framhåller att inför Förenade kungarikets utträde ur unionen behöver unionen de finansiella medel som krävs för att leva upp till medborgarnas förväntningar, för att unionen på ett effektivt sätt ska kunna ta itu med de många ovannämnda prioriteringar och utmaningar som den står inför och förbättra medborgarnas dagliga liv.

3.  Europaparlamentet påpekar att unionens medborgare förväntar sig att unionen verkligen anstränger sig för att säkerställa ekonomisk tillväxt och främja nya arbetstillfällen på ett likformigt sätt i alla sina regioner. Parlamentet påminner om att för att dessa förväntningar ska kunna infrias krävs det investeringar i forskning och innovation, digitalisering, utbildning, infrastruktur och små och medelstora företag samt främjande av sysselsättning, särskilt för ungdomarna i Europa. Parlamentet uttrycker sitt missnöje med att rådet återigen föreslår nedskärningar i just de program som syftar till att göra unionens ekonomi mer konkurrenskraftig och innovativ. Parlamentet betonar dessutom att många av dessa program, t.ex. Horisont 2020, är kraftigt övertecknade, vilket är ett dåligt utnyttjande av resurser och innebär att många utmärkta projekt inte får något stöd. Parlamentet framhåller även att program såsom Erasmus+, Horisont 2020 och programmet för företagens konkurrenskraft och små och medelstora företag (Cosme) ger en tydlig bild av fördelarna med samarbete inom unionen och bidrar till att skapa en känsla av europeisk tillhörighet. Parlamentet beslutar därför att avsevärt stärka Erasmus+ och att stärka program som bidrar till tillväxt och nya arbetstillfällen, bland annat Horisont 2020, Fonden för ett sammanlänkat Europa (FSE) och Cosme.

4.   Europaparlamentet upprepar sitt åtagande att fullgöra de utfästelser som parlamentet gjorde under förhandlingarna om Europeiska fonden för strategiska investeringar (Efsi), nämligen att begränsa effekten av Efsi-relaterade nedskärningar av Horisont 2020 och FSE inom ramen för det årliga budgetförfarandet. Parlamentet föreslår därför att man kompenserar för dessa nedskärningar genom att återställa den ursprungliga årliga profilen för dessa två program för att göra det möjligt för dem att till fullo uppnå de mål som man enades om i samband med antagandet av den relevanta lagstiftningen. 

5.  Europaparlamentet framhåller att ungdomsarbetslösheten är lägre än tidigare år, men att den fortfarande är oacceptabelt hög i vissa medlemsstater, särskilt i ekonomiskt eftersatta regioner, och att situationen för unga som varken arbetar eller studerar och långtidsarbetslösa är särskilt oroande. Parlamentet betonar att unga är den grupp som löper störst risk att drabbas av fattigdom och social och ekonomisk utestängning. Parlamentet beslutar därför att öka anslagen till ungdomssysselsättningsinitiativet över den nivå som kommissionen föreslagit. Parlamentet betonar att en sådan förstärkning inte på något sätt ska ses som en tidigareläggning av anslagen för ungdomssysselsättningsinitiativet som godkändes i samband med halvtidsrevideringen av den fleråriga budgetramen. Parlamentet understryker emellertid att ungdomssysselsättningsinitiativet bör stärkas ytterligare och göras mer effektivt för att öka dess europeiska mervärde för ungdomssysselsättningspolitiken i medlemsstaterna, särskilt genom att säkerställa att det inte ersätter finansieringen av tidigare nationell politik.

6.  Europaparlamentet påminner om att sammanhållningspolitiken spelar en primär roll för utvecklingen och tillväxten i unionen och för konvergensen i medlemsstaterna och regionerna. Parlamentet betonar sitt åtagande att säkerställa tillräckliga anslag för de program som representerar ett av unionens centrala politikområden.

7.   Europaparlamentet beklagar att enligt de nuvarande beräkningarna skulle endast 19,3 % av unionens budget för perioden 2014–2020 användas till klimatrelaterade åtgärder och att målet på 20 % – ett mål som föregick klimatavtalet i Paris – därmed inte skulle nås. Parlamentet inser att detta till stor del beror på förseningar i sammanhållningspolitiken och programmen för landsbygdsutveckling. Parlamentet uppmanar med eftertryck medlemsstaterna, som förvaltar dem, att påskynda genomförandet och att fokusera på klimatrelaterade utgifter för att kompensera för de lägre anslagen under de första åren av den fleråriga budgetramen. Parlamentet uppmanar kommissionen att utarbeta en handlingsplan inom de program som har en enorm potential för att bidra till att uppnå det klimatrelaterade utgiftsmålet. Parlamentet vill också se en kraftfull, årlig konsolidering för att göra framsteg i riktning mot klimatintegrationsmålet, med konkreta och enhetliga skyddsåtgärder som garanterar att klimatsäkra budgetbeslut är i linje med unionens åtaganden enligt Parisavtalet, och med omfattande rapportering för att inleda initiativ om målen inte uppfylls.

8.  Europaparlamentet understryker att rubrik 3 till stor del har tagits i anspråk under de senaste åren för att hantera migrations- och flyktingutmaningen och att sådana åtgärder bör fortsätta och förstärkas så länge som det behövs. Parlamentet uppmanar kommissionen att aktivt kontrollera om anslagen under rubrik 3 är tillräckliga och att till fullo använda alla tillgängliga instrument för att i tid reagera på oförutsedda händelser på migrationsområdet som skulle kunna kräva ytterligare finansiering och att fästa särskild uppmärksamhet vid de öregioner som omfattas av artikel 174 i fördraget om Europeiska unionens funktionssätt. Parlamentet beslutar att öka anslagen till asyl-, migrations- och integrationsfonden (Amif) för att till fullo täcka unionens behov på migrationsområdet, särskilt för att ge stöd till medlemsstaterna för att förbättra mottagningsförhållandena, åtgärder och praxis när det gäller integrationen av asylsökande och migranter och öka solidariteten och ansvarsfördelningen mellan medlemsstaterna samt en rättvis och effektiv återvändandepolitik. Parlamentet noterar på nytt att taket i rubrik 3 är otillräckligt för att tillhandahålla tillräckliga medel för dessa prioriteringars inre dimension samt för andra prioriterade program, t.ex. på områdena hälsa, livsmedelssäkerhet, säkerhet, rättvisa, medborgarskap och kultur. Parlamentet anser att de lokala myndigheternas beredvillighet att ge stöd till unionens vidarebosättningsprogram bör stödjas ytterligare genom den del av Amif som omfattas av direkt förvaltning.

9.  Europaparlamentet insisterar på att mot bakgrund av den senaste tidens oro för säkerheten runt om i unionen bör finansiering under rubrik 3 särskilt gå till åtgärder som leder till att öka säkerheten för unionens medborgare. Parlamentet beslutar därför att öka anslagen till Europeiska unionens byrå för samarbete inom brottsbekämpning (Europol), Europeiska unionens byrå för utbildning av tjänstemän inom brottsbekämpning (Cepol), Europeiska byrån för den operativa förvaltningen av stora it-system inom området frihet, säkerhet och rättvisa (eu-LISA), Europeiska unionens byrå för rättsligt samarbete (Eurojust) och till den nya europeiska åklagarmyndigheten, som på grund av ökad arbetsbelastning och ytterligare uppgifter har haft brist på personal och finansiering de senaste åren.

10.  Europaparlamentet upprepar att en del av lösningen på migrations- och flyktingutmaningen samt unionsmedborgarnas säkerhetsrelaterade oro består i att ta itu med de bakomliggande orsakerna till migration och att anslå tillräckliga finansiella medel till interna och externa instrument som syftar till att lösa problem som rör fattigdom, brist på sysselsättning, utbildning och ekonomiska möjligheter, instabilitet, konflikter och klimatförändringar i det europeiska grannskapet och Afrika. Parlamentet anser att unionen på bästa möjliga sätt bör utnyttja de finansiella medlen under rubrik 4, som har visat sig vara otillräckliga för att bemöta alla yttre utmaningar.

11.  Europaparlamentet konstaterar de utmaningar som det stora inflödet av migranter och asylsökande till vissa medlemsstater innebär. Parlamentet beklagar att alla ansträngningar för att skapa ett rättvist och humant system för hantering av migranter på unionsnivå hittills har misslyckats.

12.  Europaparlamentet beklagar att parlamentet inte varit vederbörligen involverat i diskussionerna om en förlängning av faciliteten för flyktingar i Turkiet. Parlamentet upprepar sin ståndpunkt sedan länge att nya initiativ inte får finansieras på bekostnad av unionens befintliga externa projekt. Parlamentet vidhåller, samtidigt som det påminner om sitt stöd för en förlängning av faciliteten för flyktingar i Turkiet, att unionens budget – med tanke på den ansträngda situationen under rubrik 4 när det gäller att hantera externa utmaningar, bland annat migration – bör bidra till finansieringen av den andra delen i samma proportion som för den första, dvs. 1 miljard EUR, medan medlemsstaterna bör bidra med 2 miljarder EUR till dess finansiering.

13.  Europaparlamentet återställer alla nedskärningar som rådet föreslår i budgetförslaget för 2019 under samtliga rubriker, med begränsade undantag under rubrik 4 och underrubrik 1b. Parlamentet vägrar acceptera de föreslagna nedskärningarna av program som ger störst europeiskt mervärde, till exempel Horisont 2020 och FSE, som är två program som redan drabbats av omfördelningar till Efsi, eller majoriteten av nedskärningarna av den yttre politiken. Parlamentet betonar att logiken bakom rådets nedskärningar inte motiveras av de verkliga genomförandesiffrorna och innebär att man bortser från det varierande genomförandemönstret för vissa program.

14.  Europaparlamentet konstaterar att för att kunna finansiera alla akuta behov på ett tillfredsställande sätt och med tanke på de mycket små eller obefintliga marginalerna under vissa rubriker 2019, kommer alla tillgängliga medel avseende flexibilitet i förordningen om den fleråriga budgetramen att behöva användas. Parlamentet förväntar sig att rådet kommer att ställa sig bakom denna strategi och att det kommer att bli enkelt att komma överens i förlikningen, så att unionen kan vara situationen vuxen och på ett ändamålsenligt sätt möta de utmaningar som väntar, särskilt med tanke på att årets förlikning kommer att vara den sista före valet till Europaparlamentet i maj 2019.

15.  Europaparlamentet fastställer den övergripande anslagsnivån för 2019 till 166 340 415 936 EUR i åtagandebemyndiganden och 149 349 039 470 EUR i betalningsbemyndiganden, vilket innebär en ökning med 721 061 034 EUR i åtagandebemyndiganden jämfört med 2019 års budgetförslag.

Underrubrik 1a – Konkurrenskraft för tillväxt och sysselsättning

16.  Europaparlamentet motsätter sig rådets omotiverade nedskärningar på 794 miljoner EUR i underrubrik 1a, som står för lite mer än hälften av rådets övergripande nedskärningar av åtagandebemyndigandena i rubrikerna i den fleråriga budgetramen. Parlamentet noterar att sådana nedskärningar strider mot rådets uttalade politiska prioriteringar. Parlamentet är dessutom bekymrat över att de kan hindra genomförandet av program som spelar en avgörande roll när det gäller att skapa arbetstillfällen och tillväxt, vilket skulle kunna inverka negativt på ekonomin.

17.  Europaparlamentet framhåller i samband med detta program såsom Horisont 2020 och FSE samt flaggskeppsprogrammen på rymdområdet, såsom Copernicus, som ger ett mycket stort europeiskt mervärde. Parlamentet beklagar de betydande nedskärningar som rådet gjort i den gemensamma strategiska ramen för forskning och innovation, vilket får en oerhört negativ inverkan på Horisont 2020, och beklagar särskilt nedskärningarna i relevanta budgetposter såsom Förstärkning av forskningen om framtida och ny teknik och Förstärkning av europeisk forskningsinfrastruktur. Parlamentet noterar också att många av dessa program utgör ett viktigt bidrag till kampen mot klimatförändringar och anser att detta bidrag bör stärkas. Parlamentet beslutar därför att återställa alla rådets nedskärningar och att dessutom till fullo återinföra den ursprungliga profilen för de Horisont 2020- och FSE-budgetposter som minskades till förmån för inbetalningar till Efsis garantifond.

18.  Europaparlamentet påminner om att Erasmus+ fortfarande är ett ytterst uppskattat och enormt populärt program som främjar rörlighet för unga i utbildningssyfte och yrkesinriktad utbildning, vilket framgår av mängden mottagna ansökningar som med råge överskrider den tillgängliga finansieringen, och noterar också att programmet bidrar till att främja en stark känsla av europeisk identitet och ett incitament för unga att delta i den europeiska demokratin. Parlamentet beklagar djupt att budgetförslaget för 2019 för Erasmus+ ligger långt under det belopp som parlamentet förväntade sig, och att det är lägre än de planerade beloppen i den nuvarande fleråriga budgetramen. Parlamentet anser därför att det är nödvändigt att stärka utbildnings- och ungdomsdelarna av Erasmus+, som en naturlig följd av förstärkningen av ungdomssysselsättningsinitiativet under underrubrik 1b.

19.  Europaparlamentet påminner om vikten av att främja omfattande synergier mellan FSE:s transportdel och FSE:s digitala del i syfte att maximera den finansiella hävstången för projekt som syftar till att stimulera digitaliseringen av TEN-T-korridorerna.

20.  Europaparlamentet framhåller på nytt att små och medelstora företag är en viktig del av unionens ekonomi och spelar en avgörande roll för att skapa arbetstillfällen i hela unionen. Parlamentet anser att det finns ett behov av att skapa ett gynnsamt företagsklimat för små och medelstora företag samt främja kluster och nätverk för små och medelstora företag och även stödja kooperativa företag med sociala, solidariska och etiska metoder. Parlamentet noterar dock med djup oro rådets nedskärningar i instrumentet för små och medelstora företag, vilket sänder ett motsägelsefullt budskap till företag i unionen. Parlamentet anser att unionens budget och dess stöd till tillgång till finansiering för nystartade företag och mikroföretag kan vara ett viktigt verktyg för att göra små och medelstora företag mer konkurrenskraftiga och mer innovativa och för att främja företagarandan i unionen. Parlamentet påminner i detta avseende om Cosme och Horisont 2020.

21.  Europaparlamentet beslutar därför att ytterligare öka anslagen över nivån i budgetförslaget för 2019 och över nivån före inrättandet av Efsi, för de program som är avgörande för att stimulera tillväxt och sysselsättning och hantera klimatförändringar och som återspeglar allmänt överenskomna unionsprioriteringar, dvs. Erasmus+, Horisont 2020 (bland annat Marie Curie-programmet, Ledarskap i rymden, Europeiska forskningsrådet, instrumentet för små och medelstora företag), Cosme, FSE och EaSI.

22.  Europaparlamentet ökar därför nivån för åtagandebemyndigandena för underrubrik 1a över nivån i budgetförslaget för 2019 med 566 773 112 EUR (utan ett återställande av nivån före Efsi, kompensation för förslaget om europeiska arbetsmyndigheten, pilotprojekt och förberedande åtgärder), som ska finansieras inom den tillgängliga marginalen och genom ett ytterligare utnyttjande av den samlade marginalen för åtaganden.

23.  Europaparlamentet välkomnar åtagandet att förnya unionens försvarsagenda, närmare bestämt genom avtalet om ett europeiskt försvarsindustriellt utvecklingsprogram. Parlamentet uttrycker sin avsikt att ägna särskild uppmärksamhet åt kommissionens genomförande av de avtal som ingåtts med avseende på det europeiska försvarsindustriella utvecklingsprogrammet och den europeiska solidaritetskåren, vilket bör redovisas i den ändringsskrivelse som kommissionen ska utfärda i oktober 2018.

Underrubrik 1b – Ekonomisk, social och territoriell sammanhållning

24.  Europaparlamentet välkomnar den minskande ungdomsarbetslösheten på unionsnivå som nu uppgår till 14,8 % (den 1 oktober 2018), men beklagar att nivån fortfarande är oacceptabelt hög i vissa medlemsstater. Parlamentet betonar att för att ta itu med denna fråga är det viktigt att säkerställa en lämplig finansiering av ungdomsgarantisystemen genom ungdomssysselsättningsinitiativet och Europeiska socialfonden (ESF). Parlamentet välkomnar överenskommelsen om behovet av att tillhandahålla nya medel för ungdomssysselsättningsinitiativet och att ta med motsvarande anslag i budgetförslaget för 2019. Parlamentet anser emellertid att mot bakgrund av de utmaningar och risker som ungdomsarbetslösheten innebär bör ungdomssysselsättningsinitiativet få ökade anslag och beslutar därför att initiativet får 580 miljoner EUR i åtaganden 2019. Parlamentet anser att denna ökning är utöver det belopp för ungdomssysselsättningsinitiativet som för närvarande planerats för perioden 2014–2020.

25.  Europaparlamentet uppmanar medlemsstaterna att se till att genomförandet av de sammanhållningspolitiska programmen påskyndas för att komma till rätta med förseningarna. Parlamentet noterar att även om rådet inte har ifrågasatt nivån på de betalningsbemyndiganden som föreslagits av kommissionen kommer parlamentet att noggrant granska kommissionens uppdaterade prognoser för att anpassa betalningsbemyndigandena till de faktiska behoven så att man undviker att det på nytt byggs upp en eftersläpning i betalningarna i slutet av den nuvarande fleråriga budgetramen.

26.  I enlighet med överenskommelsen om översynen av stödprogrammet för strukturreformer ställer sig Europaparlamentet bakom överföringen av 40 miljoner EUR i åtagandebemyndiganden och 17,2 miljoner EUR i betalningsbemyndiganden från underrubrik 1b till rubrik 2.

Rubrik 2 – Hållbar tillväxt: naturresurser

27.  Europaparlamentet påminner om att kommissionens förslag om att öka anslagen för att finansiera behoven inom ramen för Europeiska garantifonden för jordbruket (EGFJ) till stor del beror på att de tillgängliga inkomsterna för särskilda ändamål förväntas vara betydligt lägre under 2019.

28.  Europaparlamentet noterar rådets nedskärningar med 310 miljoner EUR i åtagandebemyndiganden (-0,52 % jämfört med budgetförslaget 2019) och -328,13 miljoner EUR i betalningsbemyndiganden (-0,57 % jämfört med budgetförslaget 2019), men anser att kommissionens ändringsskrivelse bör utgöra grunden för varje tillförlitlig översyn av EGFJ-anslag och återinför nivåerna i budgetförslaget för 2019 i enlighet med detta, i avvaktan på en prövning av denna ändringsskrivelse vid förlikningen.

29.   Europaparlamentet beslutar att öka anslagen till krisstöd, särskilt för fläskkött med avseende på den afrikanska svinpesten, för att minska de negativa konsekvenserna för jordbrukare och arbetstagare i de regioner som drabbats hårdast av sjukdomen. Parlamentet beslutar att uttrycka sitt starka stöd för jordbrukssektorn i unionen genom att öka anslagen till frukt och grönsaker, för att ta itu med effekterna av krisen inom sektorn och effekterna av det ryska embargot samt för åtgärder för att hantera effekterna av Xylella fastidiosa och volatiliteten i priset på olivolja.

30.  Europaparlamentet påpekar den väsentliga roll som unionens decentraliserade byråer spelar i fråga om miljö, folkhälsa och livsmedelssäkerhet för att bistå unionen och medlemsstaterna att fatta välgrundade, vetenskapligt baserade beslut om att skydda och förbättra miljön och folkhälsan och samtidigt stärka samarbetet mellan medlemsstaterna för att bemöta unionsmedborgarnas farhågor.

31.  Europaparlamentet beslutar att föreslå en ökning på 20 miljoner EUR över nivån för 2019 års budgetförslag för Europeiska jordbruksfonden för landsbygdsutveckling (EJFLU) för att främja innovation inom jordbruks- och skogsbrukssektorn och säkerställa lönsamheten och hållbarheten för dessa utkomstmöjligheter i framtiden.

32.  Europaparlamentet beslutar i enlighet med Europa 2020-målen och unionens internationella åtaganden för att bekämpa klimatförändringarna, att föreslå en ökning på 15,6 miljoner EUR över nivån i budgetförslaget för 2019 för klimatrelaterade åtgärder. Parlamentet påminner dessutom om unionens åtagande att stoppa och vända nedgången för den biologiska mångfalden och understryker att denna ökning också bidrar till skyddet av den biologiska mångfalden.

33.  Mot bakgrund av det framgångsrika slutförandet av förhandlingarna om översynen av stödprogrammet för strukturreformer beslutar Europaparlamentet att frigöra den reserv som införts av rådet för de belopp som överförts från underrubrik 1b.

34.  Europaparlamentet pekar på följderna av den extrema torka som drabbat medlemsstaterna under de senaste månaderna och som orsakar betydande förluster för jordbruket och äventyrar ett stort antal företag, och betonar i detta sammanhang behovet av att garantera stödåtgärder i syfte att bistå de värst drabbade jordbrukarna.

35.  Europaparlamentet beslutar att maximera användningen av anslagen för Poseiprogrammen i enlighet med den relevanta förordningen(9), och understryker hur viktiga dessa program är för jordbruksproducenternas motståndskraft, samt uppmärksammar den bräckliga ekonomiska situationen i de yttersta randområdena.

36.   Europaparlamentet ökar därför åtagandebemyndigandena med 154,1 miljoner EUR, exklusive pilotprojekt och förberedande åtgärder, vilket innebär att det finns en marginal på 190,8 miljoner EUR under taket för åtagandena i rubrik 2.

Rubrik 3 – Säkerhet och medborgarskap

37.  Europaparlamentet upprepar sin långvariga övertygelse om att taket för rubrik 3 har visat sig vara helt otillräckligt för att i tillräcklig utsträckning finansiera den interna dimensionen av de väsentliga utmaningarna i samband med dels den inre säkerheten och medborgarnas säkerhet och dels flyktingar och migranter.

38.  Europaparlamentet förväntar sig att trycket på dessa medlemsstaters migrations- och asylsystem, samt på deras gränser, kommer att förbli högt under 2019, liksom under kommande år, och anser därför att det behövs ytterligare finansiering på flykting- och migrationsområdet, även med tanke på framtida oförutsedda behov inom detta område. Parlamentet ökar därför anslagen till Amif när det gäller stöd till laglig migration till unionen och främjande av en effektiv integrering av tredjelandsmedborgare samt förbättringar av rättvisa och effektiva återvändandestrategier, särskilt för att hjälpa medlemsstaterna att förbättra integrationsåtgärderna för flyktingar och migranter, och särskilt för barn och ensamkommande minderåriga.

39.  Europaparlamentet välkomnar ökningen av åtagandebemyndigandena för Amif för att finansiera den nya Dublin II-lagstiftningen (förutsatt att den antas i slutet av 2018) och avvisar rådets beslut att överföra motsvarande anslag till en reserv.

40.  Europaparlamentet understryker att åtgärder för att ta itu med den inre säkerheten måste fortsätta att vara en av unionens viktigaste prioriteringar, och betonar den roll som fonden för inre säkerhet spelar som ett centralt finansieringsinstrument för att stödja medlemsstaterna på säkerhetsområdet, bland annat i kampen mot terrorism och radikalisering, allvarlig och organiserad brottslighet och cyberbrottslighet. Parlamentet beslutar därför att öka budgetanslagen för fonden för inre säkerhet, stärka stödet till gränsförvaltningen och ge stöd till offer för terroristhandlingar.

41.  Europaparlamentet påpekar den avgörande roll som unionens organ på området för rättsliga och inrikes frågor spelar när det gäller att stärka samarbetet mellan medlemsstaterna för att ta itu med unionsmedborgarnas problem. Parlamentet beslutar att öka budgetanslagen och personalstyrkan för Europol, Cepol, eu-LISA, Eurojust och Europeiska åklagarmyndigheten.

42.  Europaparlamentet insisterar i samband med detta på att Europeiska åklagarmyndigheten ges tillräcklig finansiering och personal. Parlamentet noterar att i förslaget till budget för 2019 uppgår unionens bidrag till totalt 4 911 000 EUR. Parlamentet påpekar att detta anslag är avsett att täcka Europeiska åklagarmyndighetens utgifter för personal, infrastruktur, övriga administrativa utgifter samt operativa utgifter. Parlamentet noterar att det har anslagits medel endast för 35 tjänster, vilket innebär att när de 23 tjänsterna för europeiska åklagare har dragits bort återstår endast 12 tjänster för administrativa uppgifter. Parlamentet anser att detta inte är realistiskt, särskilt med tanke på att ytterligare två medlemsstater nyligen har beslutat att ansluta sig till europeiska åklagarmyndigheten. Parlamentet beslutar därför att tidigarelägga den ökning av antalet anställda som planeras till 2020, och att anpassa lönegraderna för chefsåklagaren och de europeiska åklagarna till Olafs och Europols ledningsnivå.

43.  Europaparlamentet beklagar rådets godtyckliga nedskärningar på mer än 35 miljoner EUR i åtagandebemyndiganden till ett antal program på områdena kultur, medborgarskap, rättvisa och folkhälsa, trots dessa programs utmärkta genomförandegrad och trots den redan otillräckliga finansieringen som innebär att många högkvalitativa projekt inte får någon finansiering. Parlamentet återinför alla budgetposter till åtminstone nivån i budgetförslaget och föreslår ytterligare ökningar av relevanta budgetposter.

44.  Europaparlamentet betonar Kreativa Europas värde när det gäller att stödja unionens audiovisuella och kulturella sektorer och insisterar på att finansieringsnivåerna bör motsvara programmets ambitioner. Parlamentet efterlyser en ökning av åtagandebemyndigandena till delprogrammen Media och Kultur, bland annat för att komma till rätta med den låga andelen framgångsrika ansökningar. Parlamentet ökar också anslagen till multimedieåtgärder och till att stärka små och medelstora företags finansiella kapacitet i de europeiska kulturella och kreativa sektorerna.

45.  Europaparlamentet påminner om sitt stöd för program på områdena rättigheter, jämlikhet, medborgarskap och rättvisa. Parlamentet beslutar att öka åtagandebemyndigandena för instrument som avser icke-diskriminering och jämlikhet i allmänhet, särskilt Daphne-programmet, och att bekämpa könsrelaterat våld och upprätthålla kvinnors rättigheter och hbtqi+-personers rättigheter.

46.  Europaparlamentet påminner om att kultur- och utbildningsrelaterade projekt får stöd genom en rad unionsprogram och unionsinstrument, bland annat ESI-fonderna, Efsi och Horisont 2020. Parlamentet uppmanar med eftertryck kommissionen att förbättra programöverskridande synergier för att säkerställa ett effektivt utnyttjande av medlen. Parlamentet uppmanar särskilt kommissionen att fullt ut utnyttja de potentiella synergierna mellan olika EU-program – t.ex. Horisont 2020, FSE, Erasmus+, EaSI, Kreativa Europa och Cosme, Efsi och ESI-fonderna – för att stödja fler projekt inom de kulturella och kreativa sektorerna.

47.  Europaparlamentet förstärker rubrik 3 med 127,75 miljoner EUR i åtagandebemyndiganden, med avseende på budgetförslaget, exklusive pilotprojekt och förberedande åtgärder, och föreslår att dessa ökningar finansieras genom ett ytterligare utnyttjande av särskilda instrument.

Rubrik 4 – Europa i världen

48.  Europaparlamentet betonar att de komplicerade geopolitiska utmaningar som unionen står inför omedelbart kräver en starkare närvaro av unionen i omvärlden. Parlamentet betonar återigen att unionens yttre åtgärder endast kan vara trovärdiga om de backas upp av tillräckliga ekonomiska resurser. Parlamentet påminner om att finansieringsbehoven är mycket större än den nuvarande storleken på rubrik 4 och efterlyser ett lämpligt manöverutrymme i händelse av oförutsedda externa kriser.

49.  Europaparlamentet påminner om att genomförandet av målen för hållbar utveckling måste omfatta både unionens inre och yttre politik, och att särskilt fokus bör läggas på att tillhandahålla tillräckligt med livsmedel av god kvalitet, rent vatten och att bygga ytterligare bortskaffningsanläggningar för avloppsvatten för att uppnå hållbarhetsmål 2 och 6. Parlamentet uppmärksammar vidare omfattningen och konsekvenserna av energifattigdom i utvecklingsländerna och begär ytterligare åtgärder för att minska energifattigdomen i enlighet med hållbarhetsmål 7, särskilt i avlägset belägna landsbygdsområden i regioner som ligger utanför nätet.

50.  I detta avseende bekräftar Europaparlamentet på nytt, i linje med sin ståndpunkt i ovannämnda resolution av den 5 juli 2018, att den nuvarande andelen av stödet till faciliteten för flyktingar i Turkiet från unionens budget (1 miljard EUR) och medlemsstaterna (2 miljarder EUR) bör bibehållas för finansieringen av den andra delen av faciliteten för flyktingar i Turkiet. Parlamentet beslutar därför att minska bidragen från unionens budget från 1,45 miljarder EUR till 450 miljoner EUR. Parlamentet anser att skillnaden i stället bör finansieras av medlemsstaternas bilaterala bidrag.

51.  Europaparlamentet anser att det är av största vikt att främja fred, säkerhet och rättvisa i utvecklingsländerna om unionen ska kunna ta itu med de bakomliggande orsakerna till migration och de humanitära utmaningarna i samband med migrationen i det södra grannskapet, såsom Libyen. Parlamentet understryker vikten av att stödja goda styrelseformer, demokrati, rättsstatsprincipen och ett dynamiskt civilt samhälle för att effektivt bekämpa fattigdom på lång sikt och ta itu med de utmaningar som klimatförändringarna i utvecklingsländerna innebär. Parlamentet beslutar därför att öka resurserna till finansieringsinstrumentet för utvecklingssamarbete och södra delen av det europeiska grannskapsinstrumentet inom de olika delområdena, för att även återspegla de avsevärda påfrestningar som det europeiska grannskapsinstrumentet kommer att fortsätta att utsättas för under 2019.

52.   Europaparlamentet påminner om att unionen har åtagit sig att på ett övergripande sätt skydda och främja barns, flickors och kvinnors rättigheter samt rättigheterna för personer med funktionsnedsättningar och särskilda behov i sin yttre politik. Parlamentet betonar vikten av att genomföra EU:s riktlinjer för främjande och skydd av barnets rättigheter i Europeiska unionen, Europeiska unionens handlingsplan för jämställdhet och den europeiska politiken för personer med funktionsnedsättningar i de yttre förbindelserna. I denna anda anser parlamentet att det är lämpligt att avsätta 10 % av de tillgängliga resurserna för humanitärt bistånd till utbildning i krisområden.

53.   Europaparlamentet understryker den strategiska betydelsen av tillräcklig finansiering för västra Balkan i syfte att konsolidera vägen mot anslutning. Parlamentet förstår inte rådets förslag att minska anslagen till politiska reformer, eftersom sådana reformer utgör grunden för en eventuell demokratisk omvandling. Parlamentet betonar behovet av lämpligt ekonomiskt stöd för handlingsplanen för västra Balkan 2018–2020 och beslutar följaktligen att öka anslagen till instrumentet för stöd inför anslutningen (IPA II) för regionen.

54.  Europaparlamentet framhåller att situationen i länderna i det östra grannskapet också utgör en betydande utmaning för unionen. Parlamentet är övertygat om vikten av att tillhandahålla ytterligare finansiering för att stödja våra grannars reformsträvanden, bidra till att öka motståndskraften och främja freden och förbättra det dagliga livet för medborgarna i dessa länder.

55.  Europaparlamentet vill se ett ökat stöd från unionen till UNRWA, i linje med parlamentets resolution av den 8 februari 2018(10), med hänsyn till den förvärrade situationen på plats och Förenta staternas beslut att dra tillbaka sitt årliga bidrag till UNRWA. Parlamentet preciserar att den föreslagna ökningen uteslutande är avsedd för UNRWA i syfte att kompensera för denna förlust.

56.  Europaparlamentet är övertygat om potentialen i direkta personkontakter och ungdomars rörlighet, också som en av de centrala strategierna för att öka effekten av unionens yttre åtgärder och deras synlighet bland allmänheten i våra partnerländer. Parlamentet beslutar därför att öka bidragen från finansieringsinstrumentet för utvecklingssamarbete, det europeiska grannskapsinstrumentet, IPA II och partnerskapsinstrumentet till Erasmus+.

57.  Europaparlamentet stöder, i linje med principen om villkorlighet, en minskning av det belopp som anslagits till Turkiet under alla budgetposter, med hänsyn till den fortsatta tillbakagången vad gäller rättsstatsprincipen, demokrati och mänskliga rättigheter. Parlamentet anser samtidigt att det är nödvändigt att ytterligare stärka det direkta stödet till det civila samhället samt direkta personkontakter.

58.  Europaparlamentet anser att det är nödvändigt att öka anslagen till budgetposten för den turkcypriotiska befolkningsgruppen för att på ett avgörande sätt bidra till en fortsättning och intensifiering av uppdraget för kommittén för saknade personer i Cypern samt välbefinnandet för maroniter som vill återvända och för alla personer som lever i enklaver, i enlighet med det tredje Wienavtalet, och stödja den tekniska kommittén för kulturarvsfrågor som består av representanter för Cyperns båda befolkningsgrupper, och därmed främja förtroende och försoning mellan de två befolkningsgrupperna.

59.  Europaparlamentet konstaterar den blygsamma ökning av budgeten för den gemensamma utrikes- och säkerhetspolitiken (Gusp) som kommissionen föreslagit, men noterar att Gusp-budgeten fortfarande är under stor press och att utvidgningen av ett antal uppdrag inom den gemensamma säkerhets- och försvarspolitiken (GSFP) riskerar att förvärra detta problem under 2019. Parlamentet återställer den minskning som föreslagits av rådet för andra krishanteringsåtgärder och insatser, vilket skulle leda till mindre flexibilitet vid hanteringen av oväntade kriser.

60.  Europaparlamentet beslutar som en följd av detta att återställa nästan alla rådets nedskärningar, att förstärka rubrik 4 med 425,4 miljoner EUR över budgetförslaget för 2019 (med undantag för pilotprojekt och förberedande åtgärder), samtidigt som budgetposten för faciliteten för flyktingar i Turkiet och andra Turkietrelaterade budgetposter minskas och rådets nedskärningar med en total effekt på -1,24 miljarder EUR inte återställs, vilket resulterar i en nettoskillnad på -819,1 miljoner EUR under budgetförslaget för 2019 för rubrik 4.

Rubrik 5 – Administration: Övriga rubriker – utgifter för administration och forskningsstöd

61.  Europaparlamentet anser att rådets nedskärningar är omotiverade och inte avspeglar de verkliga behoven. Parlamentet återinför därför beloppen i budgetförslaget för 2019 för alla kommissionens administrativa utgifter, inklusive utgifter för administrativt stöd och forskningsstöd i rubrikerna 1–4.

Decentraliserade byråer

62.  Europaparlamentet stöder i stort sett kommissionens bedömning av byråernas budgetbehov. Parlamentet anser därför att ytterligare nedskärningar som föreslagits av rådet skulle äventyra byråernas goda funktion och göra det omöjligt för dem att fullfölja de uppdrag de tilldelats. Parlamentet noterar med särskild irritation att Cepols anslag på ett godtyckligt sätt skärs ned med 10 000 EUR, och uppmanar rådet att utförligt förklara för parlamentet varför man anser att sådana nedskärningar är nödvändiga och rimliga.

63.  Europaparlamentet noterar att avgiftsfinansieringen av byråerna minskar bördan för unionens budget med 1 miljard EUR per år. Parlamentet understryker att offentliga uppgifter, t.ex. på området för hälsa, miljö eller säkerhet och rättvisa, alltid bör omfattas av unionens budget. Parlamentet anser dock att kommissionen bör fortsätta att ta itu med risken för intressekonflikter som kan uppstå i de avgiftsfinansierade byråerna och vidta lämpliga åtgärder för att undvika sådana konflikter.

64.  Europaparlamentet påminner om vikten för unionen av att fokusera på konkurrenskraft för tillväxt och sysselsättning. Parlamentet anser i detta sammanhang att det behövs ytterligare anslag och personal till Europeiska byrån för GNSS (GSA) och byrån för samarbete mellan energitillsynsmyndigheter (Acer). Parlamentet noterar inrättandet av den europeiska arbetsförmedlingen och understryker behovet av att mobilisera nya resurser för denna. Parlamentet återinför de stora nedskärningar som rådet har gjort av anslagen till de europeiska tillsynsmyndigheterna (ESA-myndigheterna), samtidigt som delar av deras anslag placeras i reserven i väntan på framsteg när det gäller översynen av ESA-myndigheterna.

65.  Mot bakgrund av de utmaningar som unionen fortfarande står inför vad gäller säkerhet, och med tanke på behovet av en samordnad europeisk insats, beslutar Europaparlamentet att öka anslagen till Europol, eu-LISA, Cepol, Eurojust, Europeiska åklagarmyndigheten och Europeiska unionens byrå för nät- och informationssäkerhet (Enisa).

66.  Europaparlamentet förväntar sig att trycket på vissa medlemsstaters migrations- och asylsystem och gränser kommer att ligga kvar på en hög nivå under 2019 och eventuellt öka. Parlamentet betonar att de framtida behoven för Europeiska gräns- och kustbevakningsbyrån (Frontex) och Europeiska stödkontoret för asylfrågor (Easo), när det gäller operativa resurser och personal, måste övervakas noga och eventuellt uppdateras för 2019 års budget. Parlamentet inväntar därför kommissionens ändringsskrivelse. Parlamentet uppmanar kommissionen att så snart som möjligt ge en överblick över budgetbehoven för 2019 års budget för de föreslagna reformerna av dessa byråer.

67.  Europaparlamentet upprepar sin ståndpunkt att målet att minska antalet anställda med 5 % framgångsrikt har uppnåtts. Parlamentet uttrycker sin avsikt att lägga till ett gemensamt uttalande från alla institutioner som bekräftar slutförandet av denna engångsåtgärd. Parlamentet anser att de nya tjänster som parlamentet antagit i sin ståndpunkt behövs för att fullgöra ytterligare uppgifter till följd av ny politisk utveckling och ny lagstiftning.

68.  Europaparlamentet påminner om att den interinstitutionella arbetsgruppen om de decentraliserade byråernas resurser 2 slutförde sitt arbete genom att anta rekommendationer om de lärdomar som dragits av strategin för att uppnå personalminskningsmålet på 5 %, behandlingen av nya uppgifter, utvärderingar av byråer, byråers delning av kostnader, utvärderingen av byråer med flera placeringar och modellen för avgiftsfinansiering av byråer. Parlamentet välkomnar att institutionerna har ratificerat dessa rekommendationer. Parlamentet uttrycker sin avsikt att fortsätta att granska kommissionens arbete med dessa rekommendationer i framtiden.

Pilotprojekt och förberedande åtgärder

69.  Europaparlamentet påminner om hur viktiga pilotprojekt och förberedande åtgärder är som verktyg för att fastställa politiska prioriteringar och införa nya initiativ som kan komma att förvandlas till unionens ordinarie verksamhet och program. Efter att ha gjort en noggrann analys av alla inlämnade förslag och med beaktande av kommissionens bedömning av deras efterlevnad av lagstadgade krav och genomförbarhet, beslutar parlamentet att anta ett väl avvägt paket med pilotprojekt och förberedande åtgärder som återspeglar parlamentets politiska prioriteringar.

70.  Europaparlamentet välkomnar lanseringen av DiscoverEU, utdelningen av 15 000 Interrailkort till 18-åriga européer under 2018 liksom kommissionens förslag om 700 miljoner EUR till den fleråriga budgetramen 2021–2027, vilket stämmer väl överens med unionens ambitioner att främja rörlighet i utbildningssyfte, ett aktivt medborgarskap, social delaktighet och solidaritet för alla ungdomar. Parlamentet beslutar att fortsätta den relevanta förberedande åtgärden under 2019 och är fast beslutet att fortsätta den även under 2020.

Särskilda instrument

71.  Europaparlamentet påminner om nyttan med särskilda instrument för att ge flexibilitet utöver de ytterst snäva taken i den nuvarande fleråriga budgetramen, och välkomnar de förbättringar som halvtidsrevideringen av förordningen om den fleråriga budgetramen har inneburit. Parlamentet efterlyser en omfattande användning av flexibilitetsmekanismen och den samlade marginalen för åtaganden i budgeten för 2019 för att finansiera det stora antal nya utmaningar och nya ansvarsområden som unionens budget står inför. Parlamentet påminner också om betydelsen av Europeiska fonden för justering för globaliseringseffekter, reserven för katastrofbistånd och Europeiska unionens solidaritetsfond.

Betalningar

72.  Europaparlamentet upprepar sin oro över att underutnyttjandet av betalningsbemyndigandena, trots den senaste tidens återhämtning, har varit historiskt lågt under de tre senaste åren, särskilt i underrubrik 1b. Parlamentet beklagar att sådana förseningar hindrar unionens prioriteringar och projekt från att bidra med sin fulla potential till medborgarna i rätt tid. Parlamentet påpekar att budgetförslaget för 2019 som en följd av detta ger en aldrig tidigare skådad marginal på 19,3 miljarder EUR under betalningstaket. Parlamentet förstärker betalningsbemyndigandena för de poster där det görs ändringar av åtagandebemyndigandena.

Övriga avsnitt

Avsnitt I – Europaparlamentet

73.  Europaparlamentet bibehåller i enlighet med sin resolution om beräkning av inkomster och utgifter som antogs av kammaren den 19 april 2018(11) den totala nivån på sin budget för 2019 på 1 999 144 000 EUR. Parlamentet införlivar budgetneutrala tekniska justeringar för att återspegla aktuell information som inte var tillgänglig tidigare i år.

74.  Europaparlamentet noterar att nivån på budgetberäkningen för 2019 motsvarar 18,53 %, vilket är lägre än vad som uppnåddes 2018 (18,85 %) och den lägsta andelen av rubrik V på mer än 15 år.

75.  Europaparlamentet noterar att på grund av valet till Europaparlamentet 2019 kommer utgifterna att bli högre inom vissa områden, särskilt när det gäller ledamöter som inte återväljs och deras assistenter, samtidigt som besparingar, visserligen i mindre utsträckning, kommer att göras inom andra områden till följd av minskad parlamentarisk verksamhet under valåret.

76.  Europaparlamentet välkomnar att 2019 års budget kommer att omfatta ytterligare delbetalningar av betydande investeringar som inleddes 2016 i syfte att avsevärt förbättra parlamentets säkerhet. Parlamentet påpekar att dessa projekt omfattar olika områden och främst avser byggnader, dvs. en uppgradering av säkerheten vid ingångarna, utrustning och personal, såsom iPACS-projektet, men även förbättringar av cybersäkerheten och kommunikationssäkerheten.

77.  Europaparlamentet noterar presidiets beslut att välja två alternativ, nämligen strukturell renovering och ny utformning när det gäller vidareutvecklingen av PHS-byggnaden. Parlamentet uppmanar med eftertryck generalsekreteraren och presidiet att förse budgetmyndigheten med en detaljerad budget för vart och ett av dessa alternativ utöver de tekniska specifikationerna.

78.  Europaparlamentet minskar antalet tjänster i tjänsteförteckningen för 2019 för sitt generalsekretariat med 59 tjänster (målet att minska personalstyrkan med 1 %), i linje med den överenskommelse som nåddes med rådet den 14 november 2015 om förslaget till Europeiska unionens allmänna budget för budgetåret 2016, i vilken man enades om att parlamentets årliga personalminskningsåtgärder skulle fortsätta till och med 2019.

79.  Europaparlamentet noterar tribunalens beslut av den 25 september 2018 som bekräftar parlamentets vägran att bevilja tillgång till handlingar som rör ledamöternas traktamenten, resekostnader och ersättningen för assistentstöd till ledamöterna (dom i målen T-639/15 – T-666/15 Maria Psara m.fl. mot parlamentet och T-94/16 Gavin Sheridan mot parlamentet).

80.  Europaparlamentet påminner om att parlamentet den 23 oktober 1997 i sin resolution om den allmänna budgeten för 1998 uppmanade sitt presidium att begära att revisionsrätten skulle utreda parlamentets frivilliga pensionssystem, vilket ledde till att revisionsrätten utfärdade sitt yttrande nr 5/99 av den 16 juni 1999 om det frivilliga tilläggspensionssystemet och pensionsfonden för Europaparlamentets ledamöter. Parlamentet uppmanar nu presidiet att omgående begära att revisionsrätten lägger fram ytterligare ett sådant yttrande om pensionssystemet och pensionsfonden under 2019.

81.  Europaparlamentet påminner om att dess generalsekreterare i en not till presidiet av den 8 mars 2018 medgav att den pensionsfond som är kopplad till medlemmarnas frivilliga pensionssystem kommer att uttömma sitt kapital långt innan pensionsåtagandena upphör och eventuellt redan 2024. Parlamentet uppmanar därför generalsekreteraren och presidiet att snarast och med full respekt för ledamotsstadgan upprätta en tydlig plan för pensionsfonden som innebär att parlamentet tar på sig förpliktelserna och ansvaret för sina ledamöters frivilliga pensionssystem omedelbart efter valet 2019.

82.  Europaparlamentet begär ytterligare EU-stöd till WTO:s parlamentariska dimension, särskilt genom ökat ekonomiskt stöd och personalstöd till det ansvariga sekretariatet.

83.  Europaparlamentet uppmanar till en uppgradering av det europeiska vetenskapliga mediecentrum som antogs i budgeten för 2018 och samarbete med tv-stationer, sociala medier och ytterligare partner för att skapa utbildningsmöjligheter för unga journalister, särskilt med avseende på ny vetenskaplig och teknisk utveckling och faktabaserade, expertgranskade nyheter.

84.  Europaparlamentet påminner om revisionsrättens analys från 2014 i vilken man uppskattade kostnaderna för att parlamentets verksamhet bedrivs på olika geografiska platser till 114 miljoner EUR per år. Dessutom noterar parlamentet konstaterandet i sitt betänkande från 2013 om lokalisering av säten för Europeiska unionens institutioner(12) att 78 % av alla tjänsteresor som görs av parlamentets anställda uppstår som en direkt följd av parlamentets geografiska spridning. Parlamentet betonar att man i betänkandet också uppskattar miljökonsekvenserna av den geografiska spridningen till mellan 11 000 och 19 000 ton koldioxidutsläpp. Parlamentet påpekar på nytt allmänhetens negativa inställning på grund av denna geografiska spridning, och efterlyser därför en handlingsplan för ett enda säte och en minskning av berörda budgetposter.

85.  Europaparlamentet uppmanar bestämt generalsekreteraren att fastställa detaljerade ramar för hur parlamentet, Regionkommittén och Europeiska ekonomiska och sociala kommittén skulle kunna dela fler administrativa funktioner och tjänster.

Avsnitt IV – Domstolen

86.  Europaparlamentet återinför anslagen i budgetförslaget för 2019 för alla budgetposter där rådet gjort nedskärningar som är avgörande för att domstolen ska kunna fungera, och återinför beloppen från budgetberäkningen för två budgetposter i syfte att förbättra domstolens förmåga att hantera en allt större efterfrågan på översättningar.

87.  Europaparlamentet återinför de 16 tjänster med tillhörande anslag som kommissionen strukit i budgetförslaget för 2019 för att förhindra en flaskhals som kan vara till skada för domstolarnas produktivitet i förbindelse med domstolens nya verksamheter och den kontinuerliga ökningen av arbetsbördan. Parlamentet anser att inrättandet av 16 nya fasta tjänster för stödtjänster, som ursprungligen föreslagits av revisionsrätten och förkastats av kommissionen, bör beviljas.

Avsnitt V – Revisionsrätten

88.  Europaparlamentet återinför anslagen i 2019 års budgetförslag för alla budgetposter som rådet har skurit ned för att revisionsrätten ska kunna genomföra sitt arbetsprogram och lägga fram de planerade granskningsrapporterna.

Avsnitt VI – Europeiska ekonomiska och sociala kommittén

89.  Europaparlamentet återinför anslagen i 2019 års budgetförslag för alla budgetposter där rådet har gjort nedskärningar.

90.  Europaparlamentet ökar anslagen för ett antal budgetposter över nivån i 2019 års budgetförslag i linje med Europeiska ekonomiska och sociala kommitténs egna beräkningar.

Avsnitt VII – Regionkommittén

91.  Europaparlamentet återinför anslagen i 2019 års budgetförslag för alla budgetposter där rådet har gjort nedskärningar.

92.  Europaparlamentet ökar anslagen för ett antal budgetposter över nivån i 2019 års budgetförslag i linje med Regionkommitténs egna beräkningar.

Avsnitt VIII – Europeiska ombudsmannen

93.  Europaparlamentet bibehåller den totala nivån på ombudsmannens budget för 2019 enligt kommissionens förslag i 2019 års budgetförslag.

Avsnitt IX – Europeiska datatillsynsmannen

94.  Europaparlamentet beslutar att inte återställa budgetförslaget för 2019 för den budgetpost där rådet gjort nedskärningar på grund av en kraftig ökning av den totala budgeten jämfört med förra året.

Avsnitt X – Europeiska utrikestjänsten

95.  Europaparlamentet återinför anslagen i 2019 års budgetförslag för alla budgetposter där rådet har gjort nedskärningar.

96.  Europaparlamentet ökar anslagen för ett antal budgetposter över nivån i 2019 års budgetförslag i linje med utrikestjänstens egna beräkningar.

97.  Europaparlamentet upprepar sitt stöd för den strategiska kommunikationskapaciteten och stärker det för att genomföra en starkare samordnad EU-insats för att hantera problemet med desinformation.

98.  Europaparlamentet återinför de 28 tjänster + ytterligare 5 och anslagen för dessa som strukits av rådet, eftersom detta är en måttlig ökning av personalen som kan motiveras av utrikestjänstens betydande nya ansvarsområden, särskilt de som är kopplade till Förenade kungarikets utträde ur unionen, dvs. inrättandet av en ny EU-delegation i London och en ny enhet vid huvudkontoret, samt antagandet av ett antal initiativ på säkerhets- och försvarsområdet de senaste månaderna.

o

o  o

99.  Europaparlamentet uppdrar åt talmannen att översända denna resolution, tillsammans med ändringarna av förslaget till allmän budget, till rådet, kommissionen, övriga institutioner och berörda organ samt till de nationella parlamenten.

(1)

EUT L 168, 7.6.2014, s. 105.

(2)

EUT L 298, 26.10.2012, s. 1.

(3)

EUT L 193, 30.7.2018, s. 1.

(4)

EUT L 347, 20.12.2013, s. 884.

(5)

EUT C 373, 20.12.2013, s. 1.

(6)

Antagna texter, P8_TA(2018)0089.

(7)

Antagna texter, P8_TA(2018)0182.

(8)

Antagna texter från detta sammanträde, P8_TA(2018)0311.

(9)

Europaparlamentets och rådets förordning (EU) nr 228/2013 av den 13 mars 2013 om särskilda åtgärder inom jordbruket till förmån för unionens yttersta randområden och om upphävande av rådets förordning (EG) nr 247/2006 (EUT L 78, 20.3.2013, s. 23).

(10)

Antagna texter, P8_TA(2018)0042.

(11)

Antagna texter, P8_TA(2018)0182.

(12)

EUT C 436, 24.11.2016, s. 2.


YTTRANDE från utskottet för utrikesfrågor (31.8.2018)

till budgetutskottet

över förslaget till Europeiska unionens allmänna budget för budgetåret 2019

(2018/2046(BUD))

Föredragande av yttrande: Brando Benifei

FÖRSLAG

Utskottet för utrikesfrågor uppmanar budgetutskottet att som ansvarigt utskott infoga följande förslag i det förslag till resolution som antas:

1.  Europaparlamentet konstaterar ökningen av åtagandebemyndigandena i rubrik 4, även om den största delen av denna ökning är en följd av det ökade anslaget till faciliteten för flyktingar i Turkiet. Parlamentet betonar att med hänsyn till de många utmaningar som EU står inför på den internationella arenan kan de yttre åtgärderna endast kan vara trovärdiga om det finns tillräckliga resurser.

2.  Europaparlamentet är bekymrat över att budgetförslaget helt uttömmer marginalerna för rubrik 4, vilket ger unionen ett mycket begränsat handlingsutrymme vid oförutsedda yttre kriser.

3.  Europaparlamentet understryker den strategiska betydelsen av tillräcklig finansiering för västra Balkan, som är ett prioriterat område för EU, i syfte att konsolidera vägen mot anslutning, och beklagar i detta sammanhang förslaget att minska anslagen till politiska reformer på västra Balkan med 10 miljoner euro. Parlamentet kräver att denna trend vänds eftersom politiska reformer utgör stommen i en demokratisk omvandling och indirekt i anslutningsprocessen till EU. Parlamentet understryker behovet av tillräcklig finansiering för genomförandet av handlingsplanen för 2018–2020 för strategin för västra Balkan, med en prioritering av stödet till rättsstaten och den regionala integrationen. Parlamentet kräver att bidraget från instrumentet för stöd inför anslutningen till Erasmus+ fördubblas i enlighet med strategin.

4.  Europaparlamentet stöder, i linje med principen om villkorlighet, en minskning av det belopp som anslagits till Turkiet under alla budgetposter, med hänsyn till den fortsatta tillbakagången vad gäller rättsstatsprincipen, demokrati och mänskliga rättigheter. Samtidigt bör direkt stöd till det civila samhället och de direkta personkontakterna förstärkas ytterligare med tanke på den allt större polariseringen i det turkiska samhället och de åtgärder som myndigheterna vidtar mot de grundläggande fri- och rättigheterna och även mot människorättsförsvarare i efterdyningarna av kuppförsöket. Särskild vikt bör i detta avseende fästas vid mediernas frihet och hbti-personers rättigheter.

5.  Europaparlamentet anser att den nuvarande andelen av bidragen till faciliteten för flyktingar i Turkiet från unionens budget (1 miljard euro) och medlemsstaterna (2 miljarder euro) bör behållas. Parlamentet efterlyser en motsvarande justering av det föreslagna EU-bidraget till faciliteten för flyktingar i Turkiet för 2019, i enlighet med parlamentets ståndpunkt i dess resolution om mandatet för trepartsmötet om förslaget till budget för 2019(1). Dessutom måste det säkerställas att eventuella bidrag från rubrik 4 till faciliteten för flyktingar i Turkiet inte kommer att leda till en minskning av de tillgängliga medlen för de befintliga programmen. Parlamentet insisterar vidare på behovet av att nära kontrollera användningen av medlen till faciliteten för flyktingar i Turkiet, för att säkerställa att de verkligen används för flyktingrelaterade projekt och inte i något annat syfte. Parlamentet uppmanar kommissionen att regelbundet rapportera till budgetmyndigheten om de finansierade åtgärdernas förenlighet med den underliggande rättsliga grunden.

6.  Europaparlamentet beklagar minskningen av anslagen till finansiellt stöd för att stimulera den ekonomiska utvecklingen inom den turkcypriotiska befolkningsgruppen. Parlamentet kräver att budgeten återställs till nuvarande nivåer utan någon minskning.

7.  Europaparlamentet betonar den strategiska betydelsen av EU:s östra och södra grannskap. Parlamentet understryker att situationen i grannskapet fortfarande utgör en betydande utmaning för unionen. Parlamentet är bekymrat över att det europeiska grannskapsinstrumentet fortsatt kommer att vara utsatt för stora påfrestningar under 2019, vilket ytterligare förvärrats av att medel till det europeiska grannskapsinstrumentet används för att finansiera åtaganden som gjorts till förmån för Syrien och projekt inom ramen för EU:s förvaltningsfond för Afrika. Parlamentet kräver att dessa nya åtaganden fullt ut kompenseras av ökade anslag. Parlamentet välkomnar ökningen av åtagandebemyndigandena för förtroendeskapande åtgärder, säkerhet samt förebyggande och lösning av konflikter i länderna i Medelhavsområdet. Parlamentet understryker i detta sammanhang behovet av lämpligt stöd till utsatta grupper, i synnerhet (ensamkommande) barn, kvinnor och offer för sexuellt våld i samband med och utanför väpnade konflikter.

8.  Europaparlamentet välkomnar kommissionens avsikt att fortsätta att ge ökat stöd till Ukraina, särskilt med avseende på den ihållande konflikten i östra Ukraina, och till Tunisien, särskilt för kampen mot fattigdom och ungdomsarbetslöshet. Parlamentet kräver, i ljuset av den senaste tidens politiska utveckling på plats, mer medel till stöd för stabiliseringen av Libyen, bland annat för att stödja det civila samhället och upprätthålla människorättsnormer och internationell rätt. I detta sammanhang bör särskild uppmärksamhet ägnas åt att säkerställa att EU:s bidrag till Libyen inte används för att finansiera godtyckliga frihetsberövanden och frihetsberövanden av utsatta personer, i synnerhet barn, i enlighet med EU:s riktlinjer för främjande och skydd av barnets rättigheter, och att migranter behandlas med full respekt för internationella normer för mänskliga rättigheter. Parlamentet noterar att stabiliseringen av Libyen endast kommer att vara ett första steg och att ytterligare ansträngningar kommer att behövas för återuppbyggnad och reformer. Parlamentet kräver ökat stöd till politiska reformer och demokratiska processer i Georgien och Republiken Moldavien. Parlamentet insisterar på att en korrekt övervakning måste säkras av genomförandet av och framstegen med reformerna i de berörda partnerländerna.

9.  Europaparlamentet begär ökade anslag till det europeiska instrumentet för demokrati och mänskliga rättigheter för att skydda riskutsatta människorättsförsvarare, bland annat genom mekanismen för människorättsförsvarare (ProtectDefenders.eu), med hänsyn till de ökade tillslagen i ett antal länder. Dessutom måste tillräcklig finansiering av EU:s valövervakningsuppdrag säkerställas, som ett sätt att bidra till att stärka de demokratiska institutionerna och bygga upp allmänhetens förtroende för valprocessen, och på så sätt främja stabilitet och stärka andra utrikespolitiska mål.

10.  Europaparlamentet beklagar nedskärningarna av EU:s bidrag till Europeiska centrumet för universitetssamarbete gällande de mänskliga rättigheterna och demokratisering och dess globala högskola för mänskliga rättigheter, vilket allvarligt kommer att undergräva genomförandet av detta EU-flaggskeppsprogram för akademiker. Parlamentet uppmanar kommissionen att bibehålla det finansiella anslaget till Europeiska centrumet för universitetssamarbete gällande de mänskliga rättigheterna och demokratisering på en konsekvent nivå jämfört med tidigare bidrag.

11.  Europaparlamentet kräver att unionens stöd till fredsprocessen i Mellanöstern, den palestinska myndigheten och UNRWA stärks i linje med Europaparlamentets resolution av den 8 februari 2018 om situationen för UNRWA(2), med hänsyn till den förvärrade situationen på plats och USA:s beslut att drastiskt minska sitt engagemang. Parlamentet är fortfarande bekymrat över förstörelsen och konfiskeringen av EU-finansierat humanitärt bistånd på Västbanken.

12.  Europaparlamentet konstaterar den blygsamma ökningen av budgeten för den gemensamma utrikes- och säkerhetspolitiken (Gusp), men noterar att Gusp-budgeten fortfarande är under stor press och att utvidgningen av ett antal uppdrag inom den gemensamma säkerhets- och försvarspolitiken (GSFP) riskerar att förvärra detta problem under 2019. Parlamentet kräver att den minskning som föreslagits av rådet för andra krishanteringsåtgärder och insatser annulleras, eftersom det skulle leda till mindre flexibilitet vid hanteringen av oväntade kriser, och att Gusp-budgeten ökas i motsvarande grad.

13.  Europaparlamentet kräver ytterligare medel för instrumentet som bidrar till stabilitet och fred (IcSP), med tanke på dess viktiga roll när det gäller krishantering, krisberedskap, konfliktförebyggande och fredsbyggande. Parlamentet framhåller vikten av ett fortsatt genomförande av kopplingen mellan utveckling och säkerhet i IcSP, och efterlyser ytterligare medel som ska genomföras inom ramen för de nuvarande delarna av IcSP.

14.  Europaparlamentet betonar vikten av en progressiv utformning av EU:s gemensamma försvarspolitik och behovet av att stödja ytterligare finansiering för att säkerställa dess genomförande.

15.  Europaparlamentet gläder sig över att man nyligen antagit det europeiska försvarsindustriella utvecklingsprogrammet (EDIDP) för att stödja europeiskt försvarssamarbete och försvarsinnovation, och dess integrering i förslaget till budget för 2019. Parlamentet anser att detta program, tillsammans med den pågående förberedande åtgärden för EU:s försvarsforskning, kommer att bidra till utvecklingen av en europeisk försvarsindustri. Parlamentet betonar vikten av gränsöverskridande deltagande för små och medelstora företag och midcap-företag.

16.  Europaparlamentet kräver ökat stöd till icke-spridning och nedrustning, i enlighet med de skyldigheter som följer av fördraget om icke-spridning av kärnvapen och Europaparlamentets resolution av den 27 oktober 2016 om nukleärt säkerhetsskydd och icke-spridning(3).

17.  Europaparlamentet kräver att bidragen till Erasmus + från alla externa finansieringsinstrument ökas, eftersom kontakter mellan människor och ungdomars rörlighet är en central strategi för att öka effekten av EU:s yttre åtgärder och dess synlighet hos allmänheten i våra partnerländer.

18.  Europaparlamentet påminner om att klimatförändringarnas effekter har en påtaglig inverkan på många aspekter av människors liv och blir alltmer kännbara i utvecklingsländerna. Parlamentet kräver ökade anslag till klimatåtgärder som bättre återspeglar EU:s kraftfulla åtagande och ökade engagemang för klimatdiplomati.INFORMATION OM ANTAGANDET I DET RÅDGIVANDE UTSKOTTET

Antagande

29.8.2018

 

 

 

Slutomröstning: resultat

+:

–:

0:

43

5

8

Slutomröstning: närvarande ledamöter

Michèle Alliot-Marie, Nikos Androulakis, Petras Auštrevičius, Amjad Bashir, Bas Belder, Elmar Brok, Klaus Buchner, James Carver, Fabio Massimo Castaldo, Javier Couso Permuy, Arnaud Danjean, Anna Elżbieta Fotyga, Eugen Freund, Michael Gahler, Iveta Grigule-Pēterse, Sandra Kalniete, Manolis Kefalogiannis, Tunne Kelam, Wajid Khan, Andrey Kovatchev, Ilhan Kyuchyuk, Barbara Lochbihler, Sabine Lösing, Andrejs Mamikins, David McAllister, Tamás Meszerics, Francisco José Millán Mon, Clare Moody, Javier Nart, Pier Antonio Panzeri, Demetris Papadakis, Alojz Peterle, Tonino Picula, Julia Pitera, Cristian Dan Preda, Jozo Radoš, Sofia Sakorafa, Dobromir Sośnierz, Jaromír Štětina, Dubravka Šuica, Charles Tannock, László Tőkés, Ivo Vajgl, Elena Valenciano, Geoffrey Van Orden, Boris Zala

Slutomröstning: närvarande suppleanter

Asim Ademov, Brando Benifei, Andrea Bocskor, Tanja Fajon, Neena Gill, Ana Gomes, Liisa Jaakonsaari, Jo Leinen, Miroslav Poche, José Ignacio Salafranca Sánchez-Neyra

SLUTOMRÖSTNING MED NAMNUPPROP I DET RÅDGIVANDE UTSKOTTET

43

+

ALDE

Petras Auštrevičius, Iveta Grigule-Pēterse, Ilhan Kyuchyuk, Javier Nart, Jozo Radoš, Ivo Vajgl

EFDD

Fabio Massimo Castaldo

PPE

Asim Ademov, Michèle Alliot-Marie, Andrea Bocskor, Elmar Brok, Arnaud Danjean, Michael Gahler, Sandra Kalniete, Manolis Kefalogiannis, Tunne Kelam, Andrey Kovatchev, David McAllister, Francisco José Millán Mon, Alojz Peterle, Julia Pitera, Cristian Dan Preda, José Ignacio Salafranca Sánchez-Neyra, Jaromír Štětina, Dubravka Šuica, László Tőkés

S&D

Nikos Androulakis, Brando Benifei, Tanja Fajon, Eugen Freund, Neena Gill, Ana Gomes, Liisa Jaakonsaari, Wajid Khan, Jo Leinen, Andrejs Mamikins, Clare Moody, Pier Antonio Panzeri, Demetris Papadakis, Tonino Picula, Miroslav Poche, Elena Valenciano, Boris Zala

5

-

GUE/NGL

Javier Couso Permuy, Sabine Lösing, Sofia Sakorafa

NI

James Carver, Dobromir Sośnierz

8

0

ECR

Amjad Bashir, Bas Belder, Anna Elżbieta Fotyga, Charles Tannock, Geoffrey Van Orden

VERTS/ALE

Klaus Buchner, Barbara Lochbihler, Tamás Meszerics

Teckenförklaring:

+  :  Ja-röster

-  :  Nej-röster

0  :  Nedlagda röster

(1)

Antagna texter, P8_TA-PROV(2018)0311.

(2)

Antagna texter, P8_TA-PROV(2018)0042.

(3)

Antagna texter, P8_TA(2016)0424.


YTTRANDE från utskottet för utveckling (6.9.2018)

till budgetutskottet

över förslaget till Europeiska unionens allmänna budget för budgetåret 2019

(2018/2046(BUD))

Föredragande av yttrande: Arne Lietz

FÖRSLAG

Utskottet för utveckling uppmanar budgetutskottet att som ansvarigt utskott infoga följande förslag i det förslag till resolution som antas:

1.  Europaparlamentet betonar att målen för hållbar utveckling fram till 2030, särskilt mål 3 om hälsa, mål 4 om utbildning, mål 5 om jämställdhet mellan kvinnor och män och mål 13 om klimatåtgärder kräver lämpligt stöd från unionen och måste återspeglas i unionens budget för 2019, vilket därmed skulle visa att långsiktiga insatser för att utrota fattigdom prioriteras, i enlighet med vad som fastställs i artikel 208 i fördraget om Europeiska unionens funktionssätt (EUF-fördraget). Parlamentet påminner om att genomförandet måste omfatta både unionens inre och yttre politik samt på ett välbalanserat och sammanhängande sätt integrera de tre dimensionerna av hållbar utveckling och därmed ta hänsyn till de olika kopplingarna mellan de olika målen för hållbar utveckling. Parlamentet uppmanar kommissionen och medlemsstaterna att göra målen för hållbar utveckling fram till 2030 till en strategisk prioritering och återspegla detta i unionens budget.

2.  Parlamentet påminner om att unionen har åtagit sig att på ett övergripande sätt skydda och främja barnets rättigheter i sin yttre politik, i linje med bestämmelserna i FN:s konvention om barnets rättigheter. Parlamentet betonar vikten av att genomföra EU:s riktlinjer för främjande och skydd av barnets rättigheter i unionens yttre förbindelser. Parlamentet uppmanar kommissionen att övervaka och rapportera om framsteg med avseende på barnets rättigheter i unionens externa program.

3.  Europaparlamentet avvisar på nytt bestämt användningen av utvecklingsbistånd till mål som inte är utvecklingsrelaterade, såsom gränsförvaltning eller uppbyggnad av militär kapacitet, och understryker att finansiering som inte uppfyller kriterierna för offentligt utvecklingsbistånd helt och hållet måste komma från andra instrument än instrumentet för utvecklingssamarbete eller Europeiska utvecklingsfonden (EUF). Parlamentet upprepar att för att effektivt bekämpa fattigdom på lång sikt, och i enlighet med artikel 208 i EUF-fördraget, bör åtgärder för att ta itu med de djupt rotade orsakerna till fattigdom väljas ut framför andra som uppfyller kriterierna för offentligt utvecklingsbistånd. Parlamentet bekräftar på nytt sitt stöd för att integrera EUF i budgeten och betonar vikten av att begränsa de medel som anslagits för regionerna i Afrika, Västindien och Stillahavsområdet (AVS).

4.  Europaparlamentet betonar att även om den flexibilitet och snabbhet med vilken de aktuella beloppen kan användas är en fördel i form av en god förvaltning av medlen, kan dessa fördelar inte på något sätt motivera att utvecklingsmedel används för andra ändamål, vilket begränsar de kontrollbefogenheter som parlamentet har, vilket är det enda demokratiskt valda organet, eller den systematiska planeringen av åtgärder på lång sikt. Parlamentet vill därför se att inrättandet av extraordinära instrument såsom förvaltningsfonder begränsas i så stor utsträckning som möjligt och att hänsyn tas till dessa principer vid struktureringen av nästa fleråriga budgetram.

5.  Europaparlamentet betonar att unionen och dess medlemsstater måste uppfylla sitt kollektiva åtagande, som bekräftades 2015, att öka sitt offentliga utvecklingsbistånd till 0,7 % av sin bruttonationalinkomst (BNI) till 2030. Parlamentet påminner om unionens gemensamma åtagande att på kort sikt förse de minst utvecklade länderna med offentligt utvecklingsbistånd på mellan 0,15 % och 0,20 % av BNI. Parlamentet betonar att unionens samlade offentliga utvecklingsbistånd 2017 minskade med 2,4 % jämfört med 2016. Parlamentet är oroat över att om BNI fortfarande ligger på 0,11 % 2016 kommer unionen inte kunna fullgöra sina åtaganden gentemot de minst utvecklade länderna. Kommissionen och medlemsstaterna uppmanas att utarbeta och lägga fram en trovärdig tidsplan för en sådan gradvis ökning i riktning mot denna nivå. Parlamentet uppmanar medlemsstaterna att inte ta med kostnader för flyktingar i givarlandet vid beräkningen av det offentliga utvecklingsbiståndet. Parlamentet upprepar kommissionens åtagande om att avsätta minst 20 % av sitt totala offentliga utvecklingsbistånd till mänsklig utveckling och social delaktighet. Parlamentet kräver en ökad tilldelning av det offentliga utvecklingsbiståndet 2019 till hälso- och sjukvård, utbildning och socialt skydd för att kommissionen ska kunna fullgöra sitt åtagande före slutet av den nuvarande fleråriga budgetramen. Parlamentet betonar särskilt behovet av att främja och skydda sexuell och reproduktiv hälsa och rättigheter, och därigenom motverka den globala munkavleregel som återinfördes av den amerikanska regeringen. Parlamentet framhåller att EU:s utvecklingsbistånd bör användas mer effektivt och att utvecklingsbiståndet bör inriktas på de sektorer där det behövs mest, det vill säga kapacitetsuppbyggnad, god styrning, hälsa, utbildning, jordbruk, vattenförsörjning och sanitet samt energi. Parlamentet betonar att det behövs stöd till underhåll med tillräcklig tillgång till reservdelar och lokalt utbildade tekniska experter.

6.  Med tanke på den viktiga roll som Förenade kungariket spelar för utvecklingen insisterar Europaparlamentet på att de nära banden bibehålls mellan unionen och Förenade kungariket efter utträdet för att minimera förlusterna till följd av detta.

7.  Europaparlamentet konstaterar att inget land någonsin har utvecklas utan att inleda ytterligare handelsförbindelser med sina grannar och resten av världen. Parlamentet uppmuntrar också finansiering av handelsrelaterat bistånd, för att göra det möjligt för utvecklingsländerna att i mycket större utsträckning delta i globala värdekedjor i framtiden. Parlamentet betonar i detta sammanhang den ökade betydelsen av digital uppkoppling för att uppnå en mer balanserad fördelning av globaliseringens fördelar till förmån för utvecklingsländerna.

8.  Europaparlamentet understryker att det är mycket viktigt att stödja mikroföretag och små och medelstora företag och vill särskilt se att det skapas lokala lösningar för bättre tillgång till finansiering genom ytterligare förstärkning av mikrofinansieringslån och garantisystem,

9.  Europaparlamentet efterlyser en utvidgning av initiativet ”Erasmus för unga företagare” utanför Europa, särskilt så att det omfattar utvecklingsländer samtidigt som man tillhandahåller de ekonomiska medel som krävs.

10.  Europaparlamentet uppmuntrar till inrättandet av utbildningsinstitut för varvade yrkesutbildningar vid vilka unga människor kan genomgå professionella lärlingsprogram där tonvikten ligger på de praktiska aspekterna av ett yrke samtidigt som de deltar i teoretiska föreläsningar vid specialiserade yrkesskolor.

11.  På grund av den dramatiska situationen på området humanitärt bistånd insisterar Europaparlamentet på att de nuvarande globala humanitära behoven behöver återspeglas i en betydande ökning av anslagen till budgetposterna för humanitärt bistånd så att de blir lättare att utnyttja. Parlamentet upprepar att utbildning av både pojkar och flickor spelar en viktig roll för att förhindra mänskligt framkallade humanitära kriser genom att undvika intressekonflikter, skydda barn och ge dem perspektiv. Parlamentet välkomnar att redan en betydande del av det humanitära biståndet går till utbildning i nödsituationer. Parlamentet vill dock se en lämplig ökning av denna andel och mer stöd till budgetposten för instrumentet för utvecklingssamarbete inom Erasmus+, eftersom utbildning i nödsituationer är nödvändig för att befolkningen ska kunna utvecklas efter det att det inledande nödläget har passerat, samtidigt som man inte får glömma att detta nödläge ibland kan vara i flera år.

12.  Europaparlamentet noterar att marginalerna och flexibilitetsmekanismerna i unionens budget och unionens yttre åtgärder, som ofta används för att mobilisera ytterligare medel för att möta oförutsedda behov, inbegripet humanitära kriser, har uttömts. Parlamentet motsätter sig därför kommissionens förslag om att finansiera den andra delen av faciliteten för flyktingar i Turkiet för vilken det inte finns tillräckliga marginaler under rubrik 4 och det särskilda instrument i den fleråriga budgetramen för en oförutsedd humanitär kris, på grund av att medlemsstaterna inte har uppfyllt sitt åtagande att bilateralt bidra med 2 miljarder EUR till faciliteten för flyktingar i Turkiet. Parlamentet är oroat över den fortsatta mobiliseringen av EUF:s reserv för kompletterande bidrag till unionens förvaltningsfond för nödåtgärder i Afrika, senast med 500 miljoner EUR. Parlamentet betonar att denna överföring av medel inte bara leder till att pengar avleds från EUF:s mål om att utrota fattigdom och främja hållbar utveckling och i riktning mot migrationshantering, utan också kraftigt begränsar möjligheten att mobilisera ytterligare medel till framtida humanitära kriser i AVS-regionerna under de kommande åren. Parlamentet uppmanar återigen medlemsstaterna att öka sina bidrag till faciliteten för flyktingar i Turkiet och EU:s förvaltningsfond för Afrika, där de utlovade bidragen för närvarande uppgår till 3 miljarder EUR (före det ytterligare beloppet på 500 miljoner EUR) från unionens budget och EUF, och endast 430 miljoner EUR från EU:s medlemsstater och andra givare.

13.  Europaparlamentet anser att det är av största vikt att främja fred, säkerhet och rättvisa i utvecklingsländerna om unionen ska kunna ta itu med de bakomliggande orsakerna till migration. Parlamentet konstaterar att kostnaderna med avseende på säkerhet är särskilt relevanta för de nuvarande ansträngningarna att på ett övergripande sätt hantera kopplingen mellan säkerhet och utveckling och uppfylla mål 16 i Agenda 2030 för hållbar utveckling.

14.  Europaparlamentet understryker hur viktigt det är att öka tilldelningen av medel som syftar till att stödja god samhällsstyrning, demokrati och rättsstatsprincipen i utvecklingsländerna för att främja ansvarstagande och transparenta institutioner, stödja kapacitetsuppbyggnad och främja delaktigt beslutsfattande och allmänhetens tillgång till information.

15.  Europaparlamentet påminner om vikten av att täcka utgifter som är direkt kopplade till uppnåendet av målen för den humanitära biståndspolitiken, bland annat utgifter för tekniskt och administrativt stöd.

16.  Europaparlamentet betonar vikten av att behålla betalningsbemyndigandena i kapitlet humanitärt bistånd på åtminstone samma nivå som åtagandebemyndigandena, för att undvika en allvarlig och ständig brist på medel för betalningar, komplicerade akutinsatser och en ackumulering av obetalda räkningar, vilket fick negativa effekter även för genomförandepartnerna.

17.  Europaparlamentet betonar vikten av att tillhandahålla rent vatten och att bygga ytterligare anläggningar för bortskaffande av avloppsvatten.

18.  Europaparlamentet uppmärksammar omfattningen av och följderna av energifattigdomen i utvecklingsländerna och unionens stora engagemang för att minska denna fattigdom. Parlamentet understryker att det krävs kraftfulla och samordnade insatser från regeringarnas och intressenternas sida i de drabbade länderna för att minska energifattigdomen och uppnå hållbarhetsmål 7, särskilt i avlägset belägna landsbygdsområden i regioner som ligger utanför nätet.

19.  Europaparlamentet vill se tillräckliga finansiella resurser till FN:s hjälporganisation för Palestinaflyktingar (UNRWA) för att garantera fortsatt stöd till palestinska flyktingar i regionen.

20.  Europaparlamentet välkomnar ökningen av anslagen till stöd för utvecklingsinitiativ i utvecklingsländer som genomförs av eller för det civila samhällets organisationer och lokala myndigheter. Parlamentet påminner i samband med humanitärt bistånd kommissionen och rådet om åtagandet inom ramen för den stora uppgörelsen ”Grand Bargain” när det gäller lokalisering, som innebär ett åtagande om att betala minst en fjärdedel av allt humanitärt bistånd så direkt som möjligt till lokala och nationella aktörer, och uppmanar därför till en översyn av rådets nuvarande förordning (EG) nr 1257/96(1) (från 1996) för att se till att den framtida finansieringen av det humanitära biståndet fortsätter att grundas på behov och vara i linje med det europeiska samförståndet om humanitärt bistånd, men att den också är anpassad till en föränderlig situation och blir mer effektiv, särskilt när det gäller att främja kopplingen mellan humanitärt bistånd och utvecklingsbistånd och bidra till genomförandet av de åtaganden som gjordes vid världstoppmötet om humanitära frågor 2016, som en del av ”Grand Bargain”.

21.  Europaparlamentet upprepar vikten av att fokusera på de viktigaste humanitära kriserna, även bortglömda humanitära kriser. Parlamentet vill se garantier för humanitärt bistånd till följande kriser: Jemen (22 miljoner människor i behov av humanitärt bistånd), Syrienkrisen inklusive grannländerna (mer än 13 miljoner människor i behov av humanitärt bistånd i Syrien) och bortglömda humanitära kriser som Sahel (1,6 miljoner barn i riskzonen för grav akut undernäring och 6,8 miljoner människor som har en osäker livsmedelsförsörjning) samt Demokratiska republiken Kongo (13 miljoner människor i nöd och över 2 miljoner barn drabbade av grav akut undernäring).

22.  Europaparlamentet understryker behovet av att garantera humanitärt bistånd och utvecklingsbistånd till Sahel. Parlamentet betonar att kronisk fattigdom, klimatförändringar och ökade konflikter har lett till att 6,8 miljoner människor behöver humanitärt bistånd i en region med strukturella svagheter som begränsar möjligheterna att få tillgång till grundläggande sociala tjänster. Parlamentet vill därför se ett ökat humanitärt bistånd och utvecklingsstöd till regionen för att täcka både livräddande insatser och insatser på längre sikt för att ta itu med de bakomliggande orsakerna till sårbarhet för en osäker livsmedels- och näringsförsörjning och för att stärka grundläggande sociala tjänster.

23.  Europaparlamentet betonar att behovet av att genomföra kopplingen mellan humanitärt bistånd och utvecklingssamarbete bör återspeglas i unionens budget för 2019, genom fokusering på viktiga sektorer såsom näring. Parlamentet uppmanar därför kommissionen, särskilt generaldirektoratet för europeiskt civilskydd och humanitära biståndsåtgärder samt generaldirektoratet för internationellt samarbete och utveckling att åtgärda den humanitära och utvecklingsmässiga klyftan genom att avsätta både humanitärt bistånd och långsiktig finansiering till näring i unionens budget för 2019, vilket skulle göra det möjligt för barn med grav akut undernäring att få tillgång till behandling i alla sammanhang, både i nödsituationer och i samband med utveckling.

24.  Europaparlamentet påminner om att klimatförändringarnas effekter har en påtaglig inverkan på många aspekter av människors liv och blir alltmer kännbara i utvecklingsländerna. Parlamentet vill se ytterligare resurser från andra instrument än instrumentet för utvecklingssamarbete och/eller EUF inom klimatåtgärder, vilket återspeglar det starka åtagandet för och det ökade engagemanget i klimatdiplomatin genom att särskilt främja sektorn för förnybar energi för att ta itu med klimatförändringarna. Parlamentet påminner om att tillgång till dricksvatten är en nyckelfaktor för social och ekonomisk utveckling, vilket gör det möjligt att ta itu med fattigdom och ge tillgång till utbildning och hälso- och sjukvård. Parlamentet uppmanar medlemsstaterna och andra att hålla sig till de åtaganden som gjorts för att bekämpa den globala uppvärmningen och klimatförändringarna. Parlamentet betonar att anslaget ska komma från andra medel än utvecklingsfinansiering.

25.  Europaparlamentet påminner om att i samband med klimatförändringar och behovet av klimatanpassning är investeringar i katastrofriskreducering och beredskap i utvecklingsprogram avgörande för att förhindra mänskligt lidande och förlorade liv, bidra till att bevara resultat som uppnåtts genom utvecklingssamarbetet i partnerländerna och minska behovet av nödåtgärder.

26.  Europaparlamentet beklagar att kommissionen inte har uppfyllt målet att avsätta 20 % av sitt offentliga utvecklingsbistånd till mänsklig utveckling och social delaktighet och att kommissionen till och med minskar den berörda budgetposten. Parlamentet begär därför en kraftig ökning av dessa anslag.

27.  Europaparlamentet understryker vikten av pilotprojekt och förberedande åtgärder. Parlamentet begär ett fortsatt stöd till pågående och nya pilotprojekt och förberedande åtgärder.

28.  Europaparlamentet betonar vikten av att upprätthålla starkast möjliga samarbete med Förenade kungariket på området utvecklingssamarbete efter brexit.

29.  Europaparlamentet noterar den föreslagna ökningen med 134 % av budgetposten för samarbete med Mellanöstern och ökningen med 6 % av budgetposten för migration och asyl. Parlamentet beklagar att kommissionen inte har redogjort för dessa två ökningar i en situation då migrationsströmmarna till Europa kraftigt har minskat. Parlamentet föreslår därför en minskning av motsvarande anslag för att finansiera den nödvändiga ökningen av budgetposten för mänsklig utveckling.

INFORMATION OM ANTAGANDET I DET RÅDGIVANDE UTSKOTTET

Antagande

29.8.2018

 

 

 

Slutomröstning: resultat

+:

–:

0:

16

1

2

Slutomröstning: närvarande ledamöter

Beatriz Becerra Basterrechea, Ignazio Corrao, Mireille D’Ornano, Maria Heubuch, Teresa Jiménez-Becerril Barrio, Stelios Kouloglou, Arne Lietz, Linda McAvan, Norbert Neuser, Lola Sánchez Caldentey, Jean-Luc Schaffhauser, Mirja Vehkaperä, Bogdan Brunon Wenta, Anna Záborská, Joachim Zeller

Slutomröstning: närvarande suppleanter

Frank Engel, Cécile Kashetu Kyenge, Paul Rübig, Kathleen Van Brempt

SLUTOMRÖSTNING MED NAMNUPPROP I DET RÅDGIVANDE UTSKOTTET

16

+

ALDE

Beatriz Becerra Basterrechea, Mirja Vehkaperä

EFDD

Ignazio Corrao, Mireille D’Ornano

GUE/NGL

Stelios Kouloglou, Lola Sánchez Caldentey

PPE

Frank Engel, Teresa Jiménez‑Becerril Barrio, Paul Rübig, Bogdan Brunon Wenta

S&D

Cécile Kashetu Kyenge, Arne Lietz, Linda McAvan, Norbert Neuser, Kathleen Van Brempt

VERTS/ALE

Maria Heubuch

1

-

ENF

Jean‑Luc Schaffhauser

2

0

PPE

Joachim Zeller, Anna Záborská

Teckenförklaring:

+  :  Ja-röster

-  :  Nej-röster

0  :  Nedlagda röster

(1)

Rådets förordning (EG) nr 1257/96 av den 20 juni 1996 om humanitärt bistånd (EGT L 163, 2.7.1996, s. 1).


YTTRANDE från utskottet för internationell handel (29.8.2018)

till budgetutskottet

över Europeiska unionens allmänna budget för budgetåret 2019

(2018/2046(BUD))

Föredragande av yttrande: William (The Earl of) Dartmouth

FÖRSLAG

Utskottet för internationell handel uppmanar budgetutskottet att som ansvarigt utskott infoga följande förslag i det förslag till resolution som antas:

1.  Europaparlamentet noterar att unionens handelsagenda blir alltmer ambitiös, vilket framgår av strategin ”Handel för alla”. Parlamentet understryker att det behövs tillräckligt politiskt och administrativt stöd för att handelsavtal ska kunna ingås och ratificeras inom lämpliga tidsramar. Parlamentet betonar att medlen till Aid for Trade-initiativ bör ökas och att kommissionens GD Handel måste tilldelas tillräckliga medel så att det kan utföra det stigande antalet verksamheter, i synnerhet säkerställa genomförandet och efterlevnaden av bestämmelserna i både bilaterala och multilaterala avtal. Parlamentet betonar vikten av att göra bedömningar före, under och efter ingåendet av sådana avtal för att uppnå en mer heltäckande strategi. Parlamentet konstaterar i detta avseende att det behövs könsuppdelade uppgifter. Parlamentet upprepar att det är nödvändigt att på lämpligt sätt finansiera genomförandet av handelspolitiska skyddsåtgärder för att främja snabba utredningar och för att säkerställa att de snabbt kan antas. Parlamentet understryker att tillräckliga medel måste anslås till samarbete med och bistånd till tredjeländer för att främja och underlätta deras anslutning till bilaterala och multilaterala handelsinitiativ och handelsavtal, bl.a. Wassenaar-arrangemanget, Kimberleyprocessen och den internationella alliansen för tortyrfri handel. Parlamentet begär att man inom ramen för unionens handelsrelaterade bistånd lägger större vikt vid att stödja ökningen av den lokala och regionala handeln i partnerländerna och partnerregionerna, och därigenom stärker en självständig och varaktig nationell ekonomisk utveckling i de berörda länderna. Parlamentet uppmanar dessutom kommissionen att samordna genomförandet av den för att maximera dess effektivitet.

2.  Europaparlamentet betonar att internationell handel är ett centralt verktyg i unionens utrikespolitik och bidrar – om den ges nödvändiga ekonomiska medel och genomförs med hjälp av sammanhängande strategier – till hållbar utveckling, särskilt i utvecklingsländerna. Parlamentet anser att den gemensamma handelspolitiken är ett av unionens mest kraftfulla verktyg för att hantera orsakerna till migration.

3.  Europaparlamentet understryker att det är nödvändigt att göra en grundläggande omarbetning av EU-budgeten och dess struktur, inbegripet en mer ambitiös och betydande roll för Europaparlamentet, inom ramen för översynen av den fleråriga budgetramen och med hänsyn till den handelspolitiska agendan, och uppmanar kommissionen att ta initiativ till detta tillsammans med rådet och parlamentet.

4.  Europaparlamentet uppmanar kommissionen att utvärdera befintliga verktyg för främjande av små och medelstora företags internationalisering, både när det gäller deras samstämmighet med andra instrument till stöd för europeiska små och medelstora företag och i fråga om subsidiaritet, undvikande av dubbelhantering och komplementaritet med medlemsstaternas program. Parlamentet uppmanar kommissionen att fortsätta att finansiera internationaliseringsprogram för små och medelstora företag och att sträva efter att tillhandahålla en kalkylator för ursprungsregler som är skräddarsydd för små och medelstora företag, just för att de ska kunna använda de förmåner som är tillgängliga enligt befintliga avtal, så att dessa förmåner kommer till ökad användning.

5.  Europaparlamentet noterar att det civila samhällets och arbetsmarknadsparternas deltagande i genomförandet av handelsavtal kan gagna den gemensamma handelspolitikens legitimitet och effektivitet, att unionsmedborgarna i högre grad vill informeras och engageras i unionens handelspolitik och att kommissionen har gjort detta intresse till en prioritering. Parlamentet anser att det är av största vikt att anslå tillräckliga medel för att aktivt involvera medborgarna i utformningen av unionens handelspolitik och att främja ökade kunskaper om dess fördelar bland EU-medborgarna. Parlamentet begär att inhemska rådgivande grupper och gemensamma plattformar, som nu är underbudgeterade, involveras i medborgardialogen, eftersom de är de viktigaste verktygen för att säkra det civila samhällets effektiva deltagande i genomförandet och övervakningen av kapitlen om handel och hållbar utveckling i handelsavtalen. Parlamentet kräver att centrala resultatindikatorer utvecklas och används för att bedöma tullförvaltningars resultat på nationell nivå och EU-nivå. Parlamentet uppmanar medlemsstaterna att inta en mer aktiv roll för att förklara mervärdet av unionens handelspolitik, eftersom det är medlemsstaterna som utformar förhandlingsmandaten.

6.  Europaparlamentet betonar att det handelsrelaterade tekniska stöd och ekonomiska bistånd som tillhandahålls inom ramen för den europeiska grannskapspolitiken till unionens partner i det östra grannskapet och de länder som upplevde den arabiska våren är ett viktigt bidrag till stabiliteten i dessa regioner.

7.  Europaparlamentet uppmanar kommissionen att investera i en studie av hur unionens handelspolitik bidrar till att uppnå FN:s mål för hållbar utveckling, med rekommendationer om att anpassa politiken till Agenda 2030.

INFORMATION OM ANTAGANDET I DET RÅDGIVANDE UTSKOTTET

Antagande

29.8.2018

 

 

 

Slutomröstning: resultat

+:

–:

0:

25

3

3

Slutomröstning: närvarande ledamöter

William (The Earl of) Dartmouth, Laima Liucija Andrikienė, Maria Arena, Daniel Caspary, Salvatore Cicu, Christofer Fjellner, Karoline Graswander-Hainz, Yannick Jadot, France Jamet, Elsi Katainen, Danilo Oscar Lancini, Bernd Lange, David Martin, Emma McClarkin, Anne-Marie Mineur, Sorin Moisă, Alessia Maria Mosca, Franck Proust, Inmaculada Rodríguez-Piñero Fernández, Helmut Scholz, Joachim Schuster, Joachim Starbatty

Slutomröstning: närvarande suppleanter

Bendt Bendtsen, Seán Kelly, Sander Loones, Bolesław G. Piecha, Fernando Ruas, Paul Rübig, Lola Sánchez Caldentey, Jarosław Wałęsa

Slutomröstning: närvarande suppleanter (art. 200.2)

Nessa Childers

SLUTOMRÖSTNING MED NAMNUPPROP I DET RÅDGIVANDE UTSKOTTET

25

+

ALDE

Elsi Katainen

ECR

Sander Loones, Emma McClarkin, Bolesław G. Piecha, Joachim Starbatty

EFDD

William (The Earl of) Dartmouth

PPE

Laima Liucija Andrikienė, Bendt Bendtsen, Daniel Caspary, Salvatore Cicu, Christofer Fjellner, Seán Kelly, Sorin Moisă, Franck Proust, Fernando Ruas, Paul Rübig, Jarosław Wałęsa

S&D

Maria Arena, Nessa Childers, Karoline Graswander-Hainz, Bernd Lange, David Martin, Alessia Maria Mosca, Inmaculada Rodríguez-Piñero Fernández, Joachim Schuster

3

-

ENF

France Jamet, Danilo Oscar Lancini

GUE/NGL

Anne-Marie Mineur

3

0

GUE/NGL

Lola Sánchez Caldentey, Helmut Scholz

VERTS/ALE

Yannick Jadot

Teckenförklaring:

+  :  Ja-röster

-  :  Nej-röster

0  :  Nedlagda röster


YTTRANDE från budgetkontrollutskottet (28.9.2018)

till budgetutskottet

över förslaget till Europeiska unionens allmänna budget för budgetåret 2019

(2018/2046(BUD))

Föredragande av yttrande: Joachim Zeller

FÖRSLAG

Budgetkontrollutskottet uppmanar budgetutskottet att som ansvarigt utskott infoga följande förslag i det förslag till resolution som antas:

A.  Förslaget till unionens budget för 2019 uppgår till 166 miljarder EUR i åtagandebemyndiganden, vilket motsvarar en ökning med 3 % jämfört med 2018, i syfte att investera i en starkare och mer motståndskraftig europeisk ekonomi och främja solidaritet och säkerhet på båda sidor av unionens gränser.

B.  Utöver att konsolidera tidigare insatser innehåller detta budgetförslag också stöd till nya initiativ: den europeiska solidaritetskåren, den europeiska arbetsmyndigheten, utvidgningen av stödprogrammet för strukturreformer, inrättandet av det europeiska försvarsindustriella utvecklingsprogrammet, en reserv av räddningstjänstskapacitet på unionsnivå och inrättandet av den nya europeiska åklagarmyndigheten (EPPO).

Unionsbudgetens utformning

1.  Europaparlamentet konstaterar att unionens budget är utformad i avsnitt som motsvarar verksamheter som leds av institutionerna (verksamhetsbaserad budgetering). Parlamentet anser att denna utformning inte är någon garanti för att man får en tydlig och snabb förståelse av de eftersträvade målen. Parlamentet konstaterar däremot att den fleråriga budgetramen utformas med rubriker som motsvarar politikområden.

2.  Europaparlamentet konstaterar att de operativa program som åtföljer budgetförslaget utgör en länk mellan varje budgetpost och de politiska mål som eftersträvas.

3.  Europaparlamentet uppmanar kommissionen att utforma unionens budget i enlighet med de politiska målen i den fleråriga budgetramen.

Programförklaringar om driftsutgifter som åtföljer budgetförslaget för 2019

4.  Europaparlamentet välkomnar de programförklaringar om driftsutgifter som åtföljer 2019 års budget och som enligt artikel 38 i budgetförordningen ska tillhandahålla följande information för varje utgiftsprogram:

–  motivering och mervärde för EU av varje program,

–  översikt av genomförandet (faktiskt och framtida),

–  framstegen med programmens resultat (mål, indikatorer, delmål och mål) och bidrag till unionens politik och målsättningar.

5.  Europaparlamentet konstaterar bekymrat att kommissionen använder två uppsättningar mål och indikatorer för att mäta resultaten av den ekonomiska förvaltningen. Å ena sidan utvärderar kommissionens generaldirektörer i sina årliga verksamhetsrapporter hur mål som fastställs i förvaltningsplanen uppnåtts, och å andra sidan mäter kommissionen resultaten av utgiftsprogrammen genom programförklaringar om driftsutgifter, nästan helt utan korshänvisningar. Denna omständighet hindrar jämförbarheten mellan olika typer av resultatdokument.

6.  Europaparlamentet påpekar särskilt att generaldirektörerna i sina årliga verksamhetsrapporter rapporterar om uppnåendet av allmänna och specifika mål utan att ange motsvarande utgifter. Parlamentet uppmanar därför kommissionen att fullt ut genomföra principen om resultatbaserad budgetering för planering, genomförande och rapportering av budgeten, vilket kommer att göra det möjligt att i efterhand rapportera om de medel som används för att uppnå målen.

7.  Europaparlamentet konstaterar att programmens nuvarande resultatramar som rapporteras i programförklaringarna omfattar mer än 716 olika typer av indikatorer som mäter resultat i förhållande till 61 allmänna och 228 specifika mål.

8.  Europaparlamentet välkomnar att på detta stadium av genomförandet har faktiska resultat för nästan 90 % av indikatorerna redan rapporterats (eller delvis rapporterats). Detta är en stadig ökning jämfört med tidigare år (60 % i programförklaringarna 2017 och 80 % i programförklaringarna för 2018). Parlamentet noterar att programförklaringarna omfattar uppgifter om de faktiska resultaten för 2014–2016 eller 2017.

9.  Europaparlamentet uppmanar kommissionen att

(a)  rationalisera resultatrapporteringen genom att

–  ytterligare minska det antal mål och indikatorer som den använder för sina olika resultatrapporter och koncentrera sig på dem som bäst mäter EU-budgetens resultat, samtidigt som en standardansats undviks,

–  presentera finansiell information på ett sätt som gör att den kan jämföras med resultatinformation så att kopplingen mellan utgifter och resultat blir tydlig,

–  förklara och förbättra den övergripande enhetligheten mellan sina två uppsättningar mål och indikatorer för å ena sidan program och å andra sidan generaldirektorat,

(b)  balansera resultatrapporteringen bättre genom att tydligt informera om de största utmaningar som kvarstår.

10.  Europaparlamentet välkomnar att programförklaringarna för 2019 hänvisar till övergripande politiska mål som kampen mot klimatförändringarna, biologisk mångfald och jämställdhetsfrågor. Parlamentet uppskattar att kommissionen också presenterar de relevanta utgiftsprogram som bidrar till att förverkliga Junckerkommissionens tio prioriteringar, och framhåller de senaste och mest relevanta initiativ som bidrar till målen för hållbar utveckling, även om det ofta är på ett indirekt och icke kvantifierbart sätt.

11.  Europaparlamentet uppmanar sitt budgetutskott att i samarbete med parlamentets fackutskott främja en verklig resultatkultur som syftar till att optimera utnyttjandet av medlen samt överväga att omfördela medel från program som uppvisar svaga resultat.

Europa 2020-strategin,

12.  Europaparlamentet understryker att Europa 2020-strategin innehåller prioriterade mål och målsättningar för den nuvarande programperioden, och att unionens budget därför är ett mycket viktigt instrument för genomförandet av strategins mål och resultat. Parlamentet är dock bekymrat över att unionen, enligt centrala ekonomiska och sociala indikatorer, ännu inte har uppnått dessa mål och resultat, samtidigt som ojämlikhet och skillnader inom unionen och dess medlemsstater har fortsatt, vilket äventyrar det europeiska projektet i sig.

13.  Europaparlamentet konstaterar att enligt kommissionen uppskattas bidraget i det totala budgetförslaget för 2019 till Europa 2020-strategin till 66,2 % (106 958,3 miljoner EUR), vilket innebär att det ligger kvar på samma nivå som under tidigare år. Parlamentet insisterar på, mot bakgrund av resursbegränsningarna, att kommissionen gör sitt yttersta för att uppnå en bättre fokusering av tillgängliga resurser och en effektivare användning av anslagna medel för att avsevärt förbättra genomförandet av de huvudmål enligt Europa 2020-strategin där bristen på framsteg är mest oroande, nämligen minskningen av fattigdomsnivåerna och främjandet av social integration.

Den gemensamma jordbrukspolitiken

14.  Europaparlamentet erinrar om dagens fördelning av utgifterna inom den gemensamma jordbrukspolitiken: 44,7 % av alla unionens jordbruksföretag hade en årlig inkomst på mindre än 4 000 EUR, och i genomsnitt erhöll 10 % av mottagarna av den gemensamma jordbrukspolitikens direktstöd cirka 60 % av betalningarna under 2016. Parlamentet konstaterar att fördelningen av direktstöd till stor del återspeglar koncentrationen av jordbruksmark, då 20 % av jordbrukarna också äger 80 % av marken, men erinrar samtidigt om att det finns stora skillnader mellan enskilda medlemsstater.

15.  Europaparlamentet uppmanar kommissionen att noggrant analysera orsakerna till den allmänna nedgången i jordbrukarnas inkomster sedan 2013, särskilt när det gäller kostnaderna i förhållande till vinsterna i de olika delarna i livsmedelskedjan (producenter, bearbetningsföretag, transporter, detaljhandlare osv. - detta bör sedan visa vart de största vinsterna går), och att göra en bedömning av behoven och att fastställa ett nytt nyckelmål tillsammans med indikatorer för resultat och effekter som syftar till att minska inkomstskillnaderna mellan jordbrukare.

En snabbare sammanhållningspolitik

16.  Europaparlamentet är bekymrat över att medlemsstaterna mer än tre år efter början på perioden 2014–2020 endast har utsett 77 % av de nationella programmyndigheter som ska ansvara för sammanhållningsmedel. Den 1 mars 2017 tog kommissionen emot slutliga räkenskaper med kostnader som endast motsvarade 0,7 % av budgeten för hela programperioden. I mitten av 2017 var förseningarna i budgetgenomförandet större än vad de var vid samma tidpunkt under perioden 2007–2013. Parlamentet noterar följaktligen att de utestående åtagandena i slutet av den nuvarande finansieringsperioden kan vara högre än under den föregående.

17.  Europaparlamentet uppmanar kommissionen att påskynda genomförandet av de sammanhållningspolitiska programmen och därmed sammanhängande betalningar samt att använda de resurser som står till dess förfogande för att hjälpa medlemsstaterna att stärka sin administrativa kapacitet, i syfte att minska genomförandetiden i nästa fleråriga budgetram till år n + 2.

Den europeiska planeringsterminen

18.  Europaparlamentet uppmanar kommissionen och medlemsstaterna att bygga upp en starkare samordning mellan sammanhållning, ekonomisk styrning och den europeiska planeringsterminen i syfte att ombalansera planeringsterminen så att större prioritet läggs på att främja mer social rättvisa och social sammanhållning.

Migration

19.  Europaparlamentet noterar att kommissionen uppskattar att sammanlagt 2,3 miljarder EUR kommer att krävas under 2019 under rubrik 3 Säkerhet och medborgarskap för att möta utmaningarna i samband med migration och säkerhet, men beklagar att Europeiska revisionsrätten i sin senaste årsrapport noterat att kommissionen inte rapporterat ”det totala beloppet för medel för flykting- och migrationskrisen, och det är svårt att uppskatta” (revisionsrättens årsrapport för 2016, punkt 2.28). Parlamentet befarar att detta fortfarande är fallet i budgetförslaget för 2019 och att det därför kan göra det svårare att identifiera behov som kan uppstå. Parlamentet välkomnar att kommissionen håller på att färdigställa en fullständig översikt över uppgifter om invandring.

20.  Europaparlamentet påminner om att kommissionen anser att det är ”svårt, om inte omöjligt, att tillhandahålla en beräknad kostnad för migranter/asylsökanden land för land eftersom förvaltningen av migrationsströmmarna omfattar ett brett spektrum av verksamheter(1)” .

Finansiella instrument och förvaltningsfonder

21.  Europaparlamentet beklagar att 6,7 % av de totala betalningarna till de berörda finansieringstekniska instrumenten (900 miljoner EUR) gick till förvaltningskostnader och förvaltningsavgifter. Parlamentet anser att detta belopp är orimligt högt. Parlamentet uppmanar ännu en gång kommissionen att förbättra transparensen i användningen av finansieringstekniska instrument, att regelbundet rapportera om belåning, förluster och risker samt att lägga fram en kostnads-nyttoanalys för finansieringstekniska instrument jämfört med mer direkta former av projektfinansiering.

22.  Europaparlamentet betonar att förvaltningsfonder endast bör upprättas när deras användning är berättigad och de nödvändiga åtgärderna inte är möjliga med hjälp av andra befintliga finansieringskanaler. Parlamentet uppmanar vidare kommissionen att överväga att lägga ned förvaltningsfonder som inte kan locka till sig ett betydande bidrag från andra givare eller som inte skapar ett mervärde jämfört med EU:s traditionella externa instrument. Parlamentet anser att det är oacceptabelt att medverkan av EUF i förvaltningsfonderna ytterligare begränsar möjligheten för parlamentet att kontrollera EU:s utgifter.

Europeiska åklagarmyndigheten (EPPO)

23.  Europaparlamentet insisterar på att Europeiska åklagarmyndigheten ges tillräcklig finansiering och personal. Parlamentet noterar att i förslaget till budget för 2019 uppgår unionens bidrag till totalt 4 911 000 EUR. Detta anslag är avsett att täcka Europeiska åklagarmyndighetens utgifter för personal, infrastruktur och driftsutgifter samt operativa utgifter för att påbörja utvecklingen av Europeiska åklagarmyndighetens ärendehanteringssystem.

24.  Europaparlamentet beklagar att endast 35 tjänster föreslås, vilket innebär att när tjänsterna som biträdande åklagare (23) har dragits bort återstår endast 12 tjänster för administrativa uppgifter. Parlamentet anser att detta inte är realistiskt.

INFORMATION OM ANTAGANDET I DET RÅDGIVANDE UTSKOTTET

Antagande

27.9.2018

 

 

 

Slutomröstning: resultat

+:

–:

0

19

1

0

Slutomröstning: närvarande ledamöter

Inés Ayala Sender, Jonathan Bullock, Tamás Deutsch, Luke Ming Flanagan, Ingeborg Gräßle, Cătălin Sorin Ivan, Wolf Klinz, Arndt Kohn, Bogusław Liberadzki, Monica Macovei, Gilles Pargneaux, Georgi Pirinski, José Ignacio Salafranca Sánchez-Neyra, Claudia Schmidt, Bart Staes, Indrek Tarand, Joachim Zeller, Dennis de Jong

Slutomröstning: närvarande suppleanter

Richard Ashworth, Karin Kadenbach

SLUTOMRÖSTNING MED NAMNUPPROPI DET RÅDGIVANDE UTSKOTTET

19

+

ALDE

Wolf Klinz

ECR

Monica Macovei

GUE/NGL

Luke Ming Flanagan, Dennis de Jong

NI

Cătălin Sorin Ivan

PPE

Richard Ashworth, Tamás Deutsch, Ingeborg Gräßle, José Ignacio Salafranca Sánchez-Neyra, Claudia Schmidt, Joachim Zeller

S&D

Inés Ayala Sender, Karin Kadenbach, Arndt Kohn, Bogusław Liberadzki, Gilles Pargneaux, Georgi Pirinski

VERTS/ALE

Bart Staes, Indrek Tarand

1

-

EFDD

Jonathan Bullock

0

0

 

 

Teckenförklaring:

+  :  Ja-röster

-  :  Nej-röster

0  :  Nedlagda röster

(1)

Svar på skriftlig fråga nr 23 – CONT-utskottets utfrågning av kommissionsledamot Avramopoulos den 29 november 2016.


YTTRANDE från utskottet för ekonomi och valutafrågor (31.8.2018)

till budgetutskottet

över förslaget till Europeiska unionens allmänna budget för budgetåret 2019

(2018/2046(BUD))

Föredragande av yttrande: Luděk Niedermayer

FÖRSLAG

Utskottet för ekonomi och valutafrågor uppmanar budgetutskottet att som ansvarigt utskott infoga följande förslag i det förslag till resolution som antas:

1.  Europaparlamentet vill se en budget för 2019 som inriktas på prioriteringarna i den europeiska planeringsterminen och Europaparlamentets resolutioner, och på att hantera de frågor som är viktigast för EU-medborgarna, som helt eller delvis ligger inom EU:s ansvarsområde, och som beskrivs i t.ex. Eurobarometern 2018 där det framgår att de mest brådskande frågorna särskilt finns på säkerhets- och försvarsområdet.

2.  Europaparlamentet betonar att främjandet av en socialt balanserad och hållbar ekonomisk utveckling och tillväxt, samtidigt som man fortsätter med strukturreformer för att modernisera de europeiska ekonomierna, främjar konvergensen mellan EU:s regioner och tar itu med ungdomsarbetslösheten, tillhör de frågor som kräver brådskande åtgärder tillsammans med minskade klimatförändringar, respekt för miljön och skydd av den biologiska mångfalden, minskade ojämlikheter och finansieringen av migrations-, asyl- och flyktingpolitiken. Parlamentet understryker betydelsen av målen för en hållbar utveckling när det gäller att lösa dessa frågor.

3.  Europaparlamentet påminner om att unionsbudgeten i grunden är en investeringsbudget.

4.  Europaparlamentet understryker vikten av att säkerställa tillräckliga resurser för samordning och övervakning av den makroekonomiska politiken. Parlamentet betonar att transparent kommunikation och aktiva kontakter med allmänheten och berörda parter om EMU:s framtid, inklusive euron, bör fortsätta.

5.  Europaparlamentet betonar att de europeiska tillsynsmyndigheterna spelar en viktig roll för att stärka en genuint europeisk metod för finansiell tillsyn, främja tillsynskonvergens, en konsekvent tillämpning av unionslagstiftningen och en bättre samordning mellan nationella myndigheter, säkerställa finansiell stabilitet, främja mer välfungerande finansmarknader och säkerställa skydd för konsumenter och icke‑professionella investerare. Parlamentet uppmanar budgetutskottet att se till att tillräckliga resurser avsätts som, när de rationaliserats fullt ut, skulle göra det möjligt för de europeiska tillsynsmyndigheterna att ha tillräcklig personal och säkra och effektiva it-system samtidigt som vederbörlig hänsyn tas till den gradvis ökande mängd arbetsuppgifter som delegerats till dem.

6.  Europaparlamentet betonar att Europeiska bankmyndighetens (EBA) verksamhet inte får störas av brexit och flytten av myndigheten. Parlamentet understryker vikten av att skyndsamt slutföra den berörda lagstiftningen för att det ska finnas tillräckligt med tid för en kostnadseffektiv flytt. Parlamentet betonar att den relevanta kommande lagstiftningen fullt ut bör respektera Europaparlamentets roll i de förfaranden som leder till eventuella framtida arrangemang och omlokaliseringar av de europeiska byråerna.

7.  Europaparlamentet noterar den potentiellt markanta ökningen av de europeiska tillsynsmyndigheternas budgetberäkningar för 2019, vilket främst beror på införandet av de nya uppgifter som föreslogs i samband med översynen av de europeiska tillsynsmyndigheterna och andra lagstiftningsärenden som det pågår förhandlingar om. Parlamentet insisterar dock på full transparens när det gäller fördelningen av dessa ytterligare finansiella resurser. Parlamentet anser att det bör införas villkorade budgetposter som ska täcka kostnaden för de nya uppgifterna och att dessa ska aktiveras först när lagstiftningen har antagits. Parlamentet konstaterar att en sådan finansiering kommer att gälla tills en ny finansieringsmekanism har antagits och införts.

8.  Europaparlamentet understryker vikten av att slutföra översynen av förordningen om inrättande av europeiska tillsynsmyndigheter före utgången av Europaparlamentets åttonde mandatperiod i syfte att, beroende på omfattningen av den institutspecifika tillsynen, införa möjligheten att delvis ersätta bidrag från nationella behöriga myndigheter med lämpliga och proportionerligt anpassade avgifter för marknadsaktörerna utan att de europeiska tillsynsmyndigheternas oberoende äventyras.

9.  Europaparlamentet betonar att de europeiska tillsynsmyndigheterna ständigt bör sträva efter att öka sin effektivitet utan att göra avkall på kvaliteten i sitt arbete och fokusera på en kontinuerlig omprövning av arbetsmetoder, överföring av kunskaper och andra former av ömsesidigt bistånd mellan tillsynsmyndigheterna, liksom ett effektivt utnyttjande av personalresurser och ekonomiska resurser. Parlamentet påminner om att de europeiska tillsynsmyndigheterna strikt måste hålla sig till det mandat som de tilldelats av unionens lagstiftare och att de inte får sträva efter att i praktiken bredda sitt mandat.

10.  Europaparlamentet anser att det i budgeten för 2019 bör anslås mer resurser till mottagande och hjälp av flyktingar och migranter, särskilt till sådana medlemsstater som befinner sig vid unionens östra och södra gränser och länder som redan uppfyller sina åtaganden på området.

11.  Europaparlamentet understryker behovet av att säkerställa tillräckliga resurser för att stödja unionens åtgärder för att bekämpa aggressiv skatteplanering, skattebedrägeri och skatteundandragande.

INFORMATION OM ANTAGANDET I DET RÅDGIVANDE UTSKOTTET

Antagande

29.8.2018

 

 

 

Slutomröstning: resultat

+:

–:

0:

42

6

2

Slutomröstning: närvarande ledamöter

Hugues Bayet, Pervenche Berès, David Coburn, Thierry Cornillet, Markus Ferber, Jonás Fernández, Neena Gill, Roberto Gualtieri, Brian Hayes, Danuta Maria Hübner, Petr Ježek, Barbara Kappel, Wolf Klinz, Georgios Kyrtsos, Philippe Lamberts, Sander Loones, Bernd Lucke, Olle Ludvigsson, Ivana Maletić, Gabriel Mato, Costas Mavrides, Alex Mayer, Caroline Nagtegaal, Luděk Niedermayer, Stanisław Ożóg, Dimitrios Papadimoulis, Dariusz Rosati, Pirkko Ruohonen-Lerner, Anne Sander, Alfred Sant, Martin Schirdewan, Peter Simon, Paul Tang, Ramon Tremosa i Balcells, Ernest Urtasun, Marco Valli, Tom Vandenkendelaere, Miguel Viegas, Jakob von Weizsäcker, Marco Zanni

Slutomröstning: närvarande suppleanter

Simona Bonafè, Andrea Cozzolino, Ashley Fox, Ramón Jáuregui Atondo, Danuta Jazłowiecka, Rina Ronja Kari, Thomas Mann, Siegfried Mureşan, Andreas Schwab, Tibor Szanyi

SLUTOMRÖSTNING MED NAMNUPPROPI DET RÅDGIVANDE UTSKOTTET

42

+

ALDE

Thierry Cornillet, Petr Ježek, Wolf Klinz, Caroline Nagtegaal, Ramon Tremosa i Balcells

ECR

Ashley Fox, Sander Loones, Bernd Lucke, Stanisław Ożóg, Pirkko Ruohonen-Lerner

PPE

Markus Ferber, Brian Hayes, Danuta Maria Hübner, Danuta Jazłowiecka, Georgios Kyrtsos, Ivana Maletić, Thomas Mann, Gabriel Mato, Siegfried Mureşan, Luděk Niedermayer, Dariusz Rosati, Anne Sander, Andreas Schwab, Tom Vandenkendelaere

S&D

Hugues Bayet, Pervenche Berès, Simona Bonafè, Andrea Cozzolino, Jonás Fernández, Neena Gill, Roberto Gualtieri, Ramón Jáuregui Atondo, Olle Ludvigsson, Costas Mavrides, Alex Mayer, Alfred Sant, Peter Simon, Tibor Szanyi, Paul Tang, Jakob von Weizsäcker

VERTS/ALE

Philippe Lamberts, Ernest Urtasun

6

-

EFDD

David Coburn

ENF

Marco Zanni

GUE/NGL

Rina Ronja Kari, Dimitrios Papadimoulis, Martin Schirdewan, Miguel Viegas

2

0

EFDD

Marco Valli

ENF

Barbara Kappel

Teckenförklaring:

+  :  Ja-röster

-  :  Nej-röster

0  :  Nedlagda röster


YTTRANDE från utskottet för sysselsättning och sociala frågor (30.8.2018)

till budgetutskottet

över förslaget till Europeiska unionens allmänna budget för budgetåret 2019

(2018/2046(BUD))

Föredragande av yttrande: Marita Ulvskog

FÖRSLAG

Utskottet för sysselsättning och sociala frågor uppmanar budgetutskottet att som ansvarigt utskott infoga följande förslag i det förslag till resolution som antas:

1.  Europaparlamentet påminner om att hållbar tillväxt och investeringar är avgörande för skapandet av anständiga arbetstillfällen som leder till högkvalitativ sysselsättning samt ökat och delat välstånd för alla. Parlamentet anser att det är nödvändigt att inrikta strukturfonder och investeringar mer effektivt på att främja tillväxt för alla, minska ojämlikheterna och öka den sociala konvergensen uppåt.

2.  Europaparlamentet betonar att budgeten för 2019 bör bidra till uppnåendet av de sysselsättningsmål och sociala mål som fastställs i Europa 2020-målen i samband med genomförandet av förklaringen om den europeiska pelaren för sociala rättigheter och 2030-agendan för hållbar utveckling, i synnerhet när det gäller att bekämpa ungdoms- och långtidsarbetslöshet, växande ojämlikheter, social utestängning och fattigdom, särskilt barnfattigdom. Parlamentet betonar behovet av fortsatt stöd för att inkludera migranter.

3.  Europaparlamentet betonar att 2019 års budget inte kan betraktas separat från den fleråriga budgetramen för 2014–2020. Parlamentet framhåller att programplaneringen av anslag inom det sociala området och sysselsättningsområdet ska skapa synergier för att bidra till att minska sociala skillnader och ojämlikheter som har förvärrats av krisen. Parlamentet varnar för att eventuella minskningar av budgeten för dessa områden endast kommer att motverka insatsernas effektivitet och uppnåendet av deras mål. Parlamentet vill dock, inom ramen för de pågående budgetrestriktionerna, påminna om att principen om ett europeiskt mervärde bör utgöra hörnstenen i alla framtida utgifter och att effektiva och ändamålsenliga utgifter är lika viktiga som de totala budgettaken.

4.  Europaparlamentet förkastar alla nedskärningar i budgetplaneringen för budgetposterna för sysselsättning, socialpolitik och inkludering och betonar att en lämplig balans mellan åtagande- och betalningsbemyndiganden måste hittas så att dessa politikområden kan nå sin fulla potential. Parlamentet oroas särskilt över de nedskärningar som gjorts av rådet på dessa områden, eftersom detta kan hindra EU från att utföra sitt arbete och leva upp till medborgarnas förväntningar.

5.  Europaparlamentet noterar den övergripande ökning på årsbasis som föreslagits av kommissionen av anslagen till rubrik 1 – Smart tillväxt för alla (+3,1 % i åtagandebemyndiganden och +1,3 % i betalningsbemyndiganden).

6.  Europaparlamentet noterar den blygsamma ökning som kommissionen föreslagit av anslagen till rubrik 1b – Ekonomisk, social och territoriell sammanhållning (+2,8 % i åtagandebemyndiganden och +1,1 % i betalningsbemyndiganden).

7.  Europaparlamentet upprepar sitt krav på att tillräckliga anslag och särskilt betalningsbemyndiganden måste säkerställas i 2019 års budget för Europeiska socialfonden (ESF), eftersom ESF närmar sig en intensiv genomförandeperiod och medlemsstaternas återbetalningskrav kommer att öka, och beklagar därför den föreslagna minskningen av betalningsbemyndigandena (- 2,6 %).

8.  Europaparlamentet välkomnar förslaget att öka åtagandebemyndigandena för fonden för europeiskt bistånd till dem som har det sämst ställt (Fead) och Europeiska fonden för justering för globaliseringseffekter (+ 2 % för varje fond). Parlamentet noterar oroat minskningen (-60 %) av betalningsbemyndigandena för Europeiska fonden för justering för globaliseringseffekter liksom minskningarna (1,5 % respektive -0,4 %) av åtagande- och betalningsbemyndigandena för programmet för sysselsättning och social innovation (EaSI). Parlamentet betonar att åtagandebemyndigandena för Mikrofinansiering och socialt entreprenörskap måste behållas på en ambitiös nivå.

9.  Europaparlamentet påminner om att EU befinner sig i en situation med nästan stillastående och otillräcklig lönetillväxt i vissa medlemsstater(1), och att både kommissionen och ECB rekommenderar en allmän löneökning och en förbättring av sysselsättningens kvalitet. Parlamentet understryker vidare att de budgetposter som stöder den europeiska sociala dialogen och åtgärder för arbetsmarknadsparterna är av största vikt för att stärka arbetsmarknadsparternas involvering, bland annat i den europeiska planeringsterminen och i genomförandet av den europeiska pelaren för sociala rättigheter. Parlamentet noterar den blygsamma ökningen av åtagandebemyndigandena (6,4 %), men beklagar den minskning av betalningsbemyndigandena (-21,8 %) som föreslagits av kommissionen vad gäller relationer mellan arbetsmarknadens parter och den sociala dialogen. Parlamentet framhåller att välfungerande relationer mellan arbetsmarknadens parter har en positiv inverkan på produktiviteten, skapandet och bevarandet av sysselsättning, kvaliteten i arbetet och anständiga löner.

10.  Europaparlamentet betonar att ungdomsarbetslösheten i vissa medlemsstater förblir oacceptabelt hög i EU och att situationen för unga som varken arbetar eller studerar och långtidsarbetslösa är särskilt oroande. Parlamentet framhåller att unga är den grupp som löper störst risk att drabbas av fattigdom och social och ekonomisk utestängning. Parlamentet betonar att det för att ta itu med dessa frågor är ytterst viktigt att säkerställa fortsatt och ökad finansiering i tid till ungdomsgarantin genom ungdomssysselsättningsinitiativet, liksom tillräckligt stöd till åtgärder för att bekämpa ojämlikhet, som även sträcker sig längre än sysselsättning, genom ESF.

11.  Europaparlamentet noterar kommissionens förslag om en ökning för ungdomssysselsättningsinitiativet på 233,3 miljoner euro för 2019. Parlamentet anser dock att den övergripande budgeten för ungdomssysselsättningsinitiativet fortfarande inte är tillräcklig för att säkerställa att ungdomsgarantin når sina mål, och begär därför att åtagandebemyndigandena för ungdomssysselsättningsinitiativet bibehålls på samma nivå år 2019 som år 2018, dvs. 350 miljoner euro.

12.  Europaparlamentet betonar byråernas viktiga bidrag till behandlingen av ett brett spektrum av sysselsättningsfrågor och sociala frågor. Parlamentet betonar mot denna bakgrund att deras uppgifter hela tiden ökar och att de därför måste förses med de resurser som krävs för att de ska kunna fullgöra sina uppgifter och säkra bästa möjliga resultat i samband med stödet till EU:s lagstiftningsmässiga och politiska mål. Parlamentet beklagar därför den föreslagna minskningen i finansieringen av Cedefop (‑5,8 % i både åtaganden och betalningar). Parlamentet upprepar sin oro över de negativa budgetkonsekvenserna av den växande irländska landskoefficienten, som i allt högre grad riskerar att undergräva Eurofounds ekonomiska kapacitet att utföra sitt uppdrag. Parlamentet förväntar sig att unionens institutioner ska vidta åtgärder för att motverka dessa konsekvenser, i enlighet med vad som anges i betänkandet om beviljande av ansvarsfrihet för Eurofound för 2016. Parlamentet betonar behovet av ytterligare finansiering för att bibehålla nivån på institutets forskningsverksamhet, i synnerhet för att säkra arbetet med EU-täckande undersökningar.

13.  Europaparlamentet välkomnar inrättandet av Europeiska arbetsmyndigheten, som förväntas inleda sin verksamhet 2019. Parlamentet betonar att det är nödvändigt att tillhandahålla lämplig finansiering som motsvarar de uppgifter som fastställs i Europaparlamentets och rådets kommande förordning om inrättande av en europeisk arbetsmyndighet, i syfte att säkerställa att tillräckliga ekonomiska resurser avsätts för verksamheten. Parlamentet noterar att den finansiering som föreslagits av kommissionen (11 miljoner euro, anslagen ska föras in i reserven till dess att en grundläggande akt har antagits av lagstiftaren) är av mindre omfattning än anslagen till andra EU-byråer på området sysselsättning och sociala frågor. Parlamentet insisterar på att denna finansiering inte kan uppnås genom omfördelning av anslag från andra byråer som arbetar på området sysselsättning och sociala frågor.

14  Europaparlamentet noterar att Eures-portalen gradvis kommer att flyttas under ledning av Europeiska arbetsmyndigheten under 2019 och 2020 och ber om garantier för att denna överföring av verksamheter varken leder till nedskärningar i Eures budget eller störningar i portalens funktion.

15.  Europaparlamentet upprepar att pilotprojekt och förberedande åtgärder är mycket värdefulla verktyg för att inleda ny verksamhet och nya åtgärder inom områdena sysselsättning och social inkludering, och flera av idéerna från utskottet för sysselsättning och sociala frågor har genomförts framgångsrikt såsom pilotprojekt och förberedande åtgärder. Parlamentet uppmuntrar till ett fullständigt utnyttjande av de tillgängliga marginalerna under varje rubrik.

INFORMATION OM ANTAGANDET I DET RÅDGIVANDE UTSKOTTET

Antagande

29.8.2018

 

 

 

Slutomröstning: resultat

+:

–:

0:

32

10

1

Slutomröstning: närvarande ledamöter

Guillaume Balas, Vilija Blinkevičiūtė, Ole Christensen, Michael Detjen, Geoffroy Didier, Lampros Fountoulis, Elena Gentile, Arne Gericke, Marian Harkin, Danuta Jazłowiecka, Rina Ronja Kari, Jan Keller, Ádám Kósa, Jean Lambert, Patrick Le Hyaric, Jeroen Lenaers, Verónica Lope Fontagné, Dominique Martin, Anthea McIntyre, Miroslavs Mitrofanovs, João Pimenta Lopes, Georgi Pirinski, Dennis Radtke, Terry Reintke, Sofia Ribeiro, Claude Rolin, Siôn Simon, Romana Tomc, Ulrike Trebesius, Marita Ulvskog, Renate Weber

Slutomröstning: närvarande suppleanter

Georges Bach, Heinz K. Becker, Paloma López Bermejo, António Marinho e Pinto, Edouard Martin, Rory Palmer, Evelyn Regner, Jasenko Selimovic, Birgit Sippel, Michaela Šojdrová, Helga Stevens, Neoklis Sylikiotis

SLUTOMRÖSTNING MED NAMNUPPROP I DET RÅDGIVANDE UTSKOTTET

32

+

ALDE

Marian Harkin, António Marinho e Pinto, Jasenko Selimovic, Renate Weber

PPE

Georges Bach, Heinz K. Becker, Geoffroy Didier, Danuta Jazłowiecka, Ádám Kósa, Jeroen Lenaers, Verónica Lope Fontagné, Dennis Radtke, Sofia Ribeiro, Claude Rolin, Michaela Šojdrová, Romana Tomc

S&D

Guillaume Balas, Vilija Blinkevičiūtė, Ole Christensen, Michael Detjen, Elena Gentile, Jan Keller, Edouard Martin, Rory Palmer, Georgi Pirinski, Evelyn Regner, Siôn Simon, Birgit Sippel, Marita Ulvskog

VERTS/ALE

Jean Lambert, Miroslavs Mitrofanovs, Terry Reintke

10

-

ECR

Arne Gericke, Anthea McIntyre, Helga Stevens, Ulrike Trebesius

ENF

Dominique Martin

GUE/NGL

Rina Ronja Kari, Patrick Le Hyaric, João Pimenta Lopes, Neoklis Sylikiotis

NI

Lampros Fountoulis

1

0

GUE/NGL

Paloma López Bermejo

Teckenförklaring:

+  :  Ja-röster

-  :  Nej-röster

0  :  Nedlagda röster

(1)

Se t.ex. Europeiska planeringsterminen 2017: Meddelande från kommissionen om landsspecifika rekommendationer, s. 3 och 8. https://ec.europa.eu/info/sites/info/files/2017-european-semester-country-specific-recommendations-commission-recommendations-communication.pdf

I synnerhet:

Rekommendation nr 2 för Tyskland: https://ec.europa.eu/info/sites/info/files/file_import/2018-european-semester-country-specific-recommendation-commission-recommendation-germany-en.pdf

Rekommendation nr 2 för Nederländerna: https://ec.europa.eu/info/sites/info/files/file_import/2018-european-semester-country-specific-recommendation-commission-recommendation-netherlands-en.pdf


YTTRANDE från utskottet för miljö, folkhälsa och livsmedelssäkerhet (30.8.2018)

till budgetutskottet

över förslaget till Europeiska unionens allmänna budget för budgetåret 2019

(2018/2046(BUD))

Föredragande av yttrande: Adina-Ioana Vălean

FÖRSLAG

Utskottet för miljö, folkhälsa och livsmedelssäkerhet uppmanar budgetutskottet att som ansvarigt utskott infoga följande förslag i det förslag till resolution som antas:

1.  Europaparlamentet understryker att 20,1 % av de totala åtagandena i budgetförslaget för 2019 är klimatrelaterade. Parlamentet beklagar att trenden för unionsbudgeten, trots målsättningen att 20 % av unionens budgetutgifter ska kopplas till åtgärder mot klimatförändringen, antyder att endast 19,3 % kommer att uppnås under den nuvarande perioden för den fleråriga budgetramen. Parlamentet betonar att alla tänkbara insatser bör göras för att nå målet på 20 %. Parlamentet framhåller att tillräckligt finansiellt stöd är avgörande för begränsning av och anpassning till klimatförändringarna.

2.  Europaparlamentet noterar att 8,2 % av de totala åtagandena är avsedda att vända den nedåtgående trenden för den biologiska mångfalden. Parlamentet begär att tillräckliga medel anslås till skydd av den biologiska mångfalden. Parlamentet påminner om att det i kommissionens meddelande En budget för Europa 2020 konstateras att finansieringen av strategin för biologisk mångfald i unionen fram till 2020, liksom målet att stoppa och vända den minskade biologiska mångfalden i unionen, kräver att biologisk mångfald integreras i hela unionsbudgeten.

3.  Europaparlamentet noterar ökningen på 31,3 miljoner EUR i åtaganden för Life (+6 %). Parlamentet beklagar att Life bara motsvarar 0,3 % av budgetförslaget för 2019.

4.  Europaparlamentet noterar att 68,3 miljoner EUR har föreslagits i åtaganden (+2,9 %) och 61,3 miljoner EUR i betalningar (+9,6 %) för hälsa. Parlamentet beklagar att detta belopp endast motsvarar 0,04 % av budgetförslaget för 2019 och 1,8 % av rubrik 3 (i åtaganden).

5.  Europaparlamentet anser att resurserna för hälsa bör höjas, särskilt sådana som går till forskning om psykiska sjukdomar. Kommissionen uppmanas att göra undersökningar och informera parlamentet om vilka program som kan genomföras för att öka de resurser som är avsedda för forskning och utveckling på detta område inom ramen för den framtida fleråriga budgetramen.

6.  Europaparlamentet noterar att 297,7 miljoner EUR har föreslagits i åtaganden (+6,3 %) och 245,8 miljoner EUR i betalningar (-1 %) för livsmedel och foder. Parlamentet beklagar att detta belopp endast motsvarar 0,18 % av budgetförslaget för 2019 och 8 % av rubrik 3 (i åtaganden).

7.  Europaparlamentet noterar ökningen av åtaganden för unionens civilskyddsmekanism (149,6 miljoner EUR, dvs. +350 %), som är en hörnsten i unionens solidaritet. Parlamentet betonar att denna ökning är nödvändig eftersom budgetförslaget för 2019 omfattar effekterna av kommissionens förslag om översyn av civilskyddsmekanismen.

8.  Europaparlamentet konstaterar att antalet fasta och tillfälliga tjänster som godkänts enligt budgetförslaget för 2019 förblir oförändrade jämfört med 2018 års budget för Europeiskt centrum för förebyggande och kontroll av sjukdomar (ECDC), Europeiska miljöbyrån (EEA) och Europeiska läkemedelsmyndigheten (EMA), medan antalet sådana tjänster ökar för Europeiska myndigheten för livsmedelssäkerhet (Efsa) (+1)(1) och Europeiska kemikaliemyndigheten (Echa) (+3). Parlamentet betonar att dessa byråer vid behov måste tilldelas ytterligare ekonomiska resurser och personalresurser för att de ska kunna uppfylla sitt mandat och utföra sina uppgifter och för att främja ett vetenskapligt baserat tillvägagångssätt i unionen.

9.  Europaparlamentet konstaterar att de tillfälliga tjänster som godkänts i 2019 års budgetförslag för Echa kommer att öka med tre. Parlamentet påpekar att denna ökning är avsedd att föra nivån på Echas biocidresurser närmare den som ursprungligen planerades och kompensera för de resurser som saknats under 2018. Parlamentet noterar dock att Echa har fått ytterligare uppgifter enligt Europaparlamentets och rådets reviderade direktiv 2008/98/EG(2) (ramdirektivet om avfall) för vilka inga budgetposter eller finansiering för närvarande planerats i budgetförslaget för 2019. Parlamentet noterar vidare att nya uppgifter för Echa också planeras i den pågående översynen av Europaparlamentets och rådets förordning (EG) nr 850/2004(3) om långlivade organiska föroreningar och i systemet för EU:s giftinformationscentraler, och begär att tillräckliga resurser ska göras tillgängliga för Echa för att genomföra dessa nya åtgärder.

10.  Europaparlamentet betonar att EEA, utöver en betydande ökning av de befintliga uppgifterna, har tilldelats nya ansvarsområden som leder till en ökning av EEA:s finansiella behov och personalbehov, samtidigt som målen för personalminskning och budgetstabilisering respekteras. Parlamentet betonar att utan en utökning av tjänsteförteckningen finns det en risk för betydande störningar i EEA:s förmåga att stödja utarbetandet och genomförandet av miljöpolitiken på unionsnivå och nationell nivå.

11.  Europaparlamentet noterar att EMA står inför en ökad arbetsbelastning och ytterligare budgetbehov 2019 som en följd av Förenade kungarikets beslut att lämna unionen. Parlamentet anser att ytterligare finansiella resurser och personal bör godkännas för en begränsad period så att EMA kan överföra och behålla de kritiska kunskaper och färdigheter som krävs för att EMA på ett effektivt sätt ska kunna utföra sina uppgifter och återuppta nu uppskjuten verksamhet.

12.  Europaparlamentet uppmanar kommissionen att snabbt genomföra pilotprojekt och förberedande åtgärder på områdena miljö, folkhälsa och livsmedelssäkerhet.

13.  Europaparlamentet påminner om att pilotprojekt och förberedande åtgärder på områdena miljö, folkhälsa och livsmedelssäkerhet bör få tillräcklig finansiering under hela sin livscykel, så att de kan nå sin fulla potential.

14.  Europaparlamentet påminner om principen om ansvarsskyldighet inför skattebetalare och konsumenter, och efterlyser därför en sträng årlig budgetdisciplin, i syfte att ta hänsyn till den finansiella börda som läggs på medborgarna. Parlamentet betonar att kostnadseffektiviteten i nuvarande politik, program och åtgärder bör ses över varje år och att lämpliga åtgärder bör vidtas när så krävs.

INFORMATION OM ANTAGANDET I DET RÅDGIVANDE UTSKOTTET

Antagande

30.8.2018

 

 

 

Slutomröstning: resultat

+:

–:

0:

40

6

1

Slutomröstning: närvarande ledamöter

Margrete Auken, Pilar Ayuso, Ivo Belet, Paul Brannen, Soledad Cabezón Ruiz, Nessa Childers, Birgit Collin-Langen, Miriam Dalli, Angélique Delahaye, Mark Demesmaeker, Stefan Eck, José Inácio Faria, Karl-Heinz Florenz, Francesc Gambús, Arne Gericke, Jens Gieseke, Françoise Grossetête, Benedek Jávor, Karin Kadenbach, Urszula Krupa, Giovanni La Via, Susanne Melior, Miroslav Mikolášik, Rory Palmer, Massimo Paolucci, Piernicola Pedicini, Bolesław G. Piecha, Pavel Poc, John Procter, Michèle Rivasi, Annie Schreijer-Pierik, Renate Sommer, Claudiu Ciprian Tănăsescu, Adina-Ioana Vălean, Jadwiga Wiśniewska, Damiano Zoffoli

Slutomröstning: närvarande suppleanter

Guillaume Balas, Cristian-Silviu Buşoi, Elena Gentile, Anja Hazekamp, Norbert Lins, Younous Omarjee, Christel Schaldemose, Bart Staes, Keith Taylor, Carlos Zorrinho

Slutomröstning: närvarande suppleanter (art. 200.2)

Olle Ludvigsson

SLUTOMRÖSTNING MED NAMNUPPROP I DET RÅDGIVANDE UTSKOTTET

40

+

EFDD

Piernicola Pedicini

GUE/NGL

Stefan Eck, Anja Hazekamp

PPE

Pilar Ayuso, Ivo Belet, Cristian-Silviu Buşoi, Birgit Collin-Langen, Angélique Delahaye, José Inácio Faria, Karl-Heinz Florenz, Francesc Gambús, Jens Gieseke, Françoise Grossetête, Giovanni La Via, Norbert Lins, Miroslav Mikolášik, Annie Schreijer-Pierik, Renate Sommer, Adina-Ioana Vălean

S&D

Guillaume Balas, Paul Brannen, Soledad Cabezón Ruiz, Nessa Childers, Miriam Dalli, Elena Gentile, Karin Kadenbach, Olle Ludvigsson, Susanne Melior, Rory Palmer, Massimo Paolucci, Pavel Poc, Christel Schaldemose, Claudiu Ciprian Tănăsescu, Damiano Zoffoli, Carlos Zorrinho

VERTS/ALE

Margrete Auken, Benedek Jávor, Michèle Rivasi, Bart Staes, Keith Taylor

6

-

ECR

Mark Demesmaeker, Arne Gericke, Urszula Krupa, Bolesław G. Piecha, John Procter, Jadwiga Wiśniewska

1

0

GUE/NGL

Younous Omarjee

Teckenförklaring:

+  :  Ja-röster

-  :  Nej-röster

0  :  Nedlagda röster

(1)

Efsa har begärt ytterligare en tjänst för att tillsätta tjänsten som chef för stödkontoret för EU:s byråer i Bryssel. Finansieringen av denna tjänst kommer att delas mellan EU:s byråer och kommer inte att kräva några ytterligare budgetmedel i detta avseende.

(2)

Europaparlamentets och rådets direktiv 2008/98/EG av den 19 november 2008 om avfall och om upphävande av vissa direktiv (EUT L 312, 22.11.2008, s. 3), senast ändrat genom Europaparlamentets och rådets direktiv (EU) 2018/851 av den 30 maj 2018 (EUT L 150, 14.6.2018, s. 109).

(3)

  Europaparlamentets och rådets förordning (EG) nr 850/2004 av den 29 april 2004 om långlivade organiska föroreningar och om ändring av direktiv 79/117/EEG (EUT L 158, 30.4.2004, s. 7).


YTTRANDE från utskottet för industrifrågor, forskning och energi (25.9.2018)

till budgetutskottet

över förslaget till Europeiska unionens allmänna budget för budgetåret 2019

(2018/2046(BUD))

Föredragande av yttrande: Jens Geier

FÖRSLAG

Utskottet för industrifrågor, forskning och energi uppmanar budgetutskottet att som ansvarigt utskott infoga följande förslag i det förslag till resolution som antas:

1.  Europaparlamentet motsätter sig rådets minskning av åtagandebemyndigandena med 3,61 % och av betalningsbemyndigandena med 0,22 % för budgetposter som rör ITRE‑utskottet inom rubrik 1a i unionens budget för 2019 jämfört med kommissionens förslag. Parlamentet noterar ökningen i kommissionens förslag av åtagandebemyndigandena med 3,9 % och av betalningsbemyndigandena med 1,8 % för budgetposter som rör ITRE-utskottets ansvarsområde inom rubrik 1a i unionens budget jämfört med 2018. Parlamentet välkomnar vidare fokuseringen i 2019 års budget på tillväxt, innovation, konkurrenskraft, digitalisering, hållbarhet, klimatförändringar och övergången till en ekonomi som präglas av hög energieffektivitet och baserar sig på förnybar energi, i överensstämmelse med Parisavtalet, och på framgången för unga och kvinnliga forskare och entreprenörer.

2.  Europaparlamentet anser att forskning, små och medelstora företag och konkurrenskraft även i fortsättningen kommer att bidra på ett avgörande sätt till skapandet av arbetstillfällen och tillväxt över hela unionen. Parlamentet anser att budgetanslagen 2019 för de framgångsrika programmen Horisont 2020 och Cosme måste vara tillräckliga för att säkra deras fortsatta verksamhet.

3.  Europaparlamentet betonar behovet av att utveckla ledarskap inom innovation och banbrytande teknik. Parlamentet beklagar därför de betydande nedskärningar som rådet gjort på 0,3 miljarder EUR i åtagandebemyndiganden och 18 miljoner EUR i betalningsbemyndiganden i fråga om den gemensamma strategiska ramen för forskning och innovation, vilket får en överväldigande negativ inverkan på Horisont 2020. Parlamentet beklagar särskilt nedskärningarna i relevanta budgetposter, såsom Förstärkning av forskningen om framtida och ny teknik och Förstärkning av europeisk forskningsinfrastruktur, vilka syftar till att höja levnadsstandarden, förbättra tillgången till kunskap samt främja social och ekonomisk utveckling. Parlamentet noterar den föreslagna ökningen i kommissionens förslag med 8,5 % för Horisont 2020 i åtagandebemyndiganden för 2019 års allmänna budget. Parlamentet påminner om den stora underfinansieringen av Horisont 2020 inom ramen för den fleråriga budgetramen 2014–2020, vilket resulterar i en lägre andel (11,6 % och så lågt som 3 % för vissa program) framgångsrika ansökningar än under den föregående fleråriga budgetramen, och därmed att färre högkvalitativa projekt inom forskning och innovation får EU‑medel. Parlamentet upprepar därför att det är mycket oroat över den låga finansieringsnivå för Horisont Europa som kommissionen föreslagit för nästa fleråriga budgetram, och avser att säkerställa ett absolut minimum på 120 miljarder EUR i 2018 års priser för detta program under de kommande förhandlingarna om den fleråriga budgetramen för 2021–2027, och understryker sin ståndpunkt att klimatrelaterade utgifter enligt Parisavtalet bör ökas betydligt jämfört med den nuvarande fleråriga budgetramen.

4.  Europaparlamentet anser att 2019 års budget bör användas för att stödja alla relevanta instrument för att bekämpa ungdomsarbetslösheten, i synnerhet i ekonomiskt eftersatta regioner i EU, med fokus på främjande av företag och digitala färdigheter.

5.  Europaparlamentet konstaterar betydelsen och resultaten av Europeiska fonden för strategiska investeringar (Efsi). Parlamentet beklagar att man för att säkra extra finansiering för Efsi var tvungen att minska anslagen till Horisont 2020. Parlamentet betonar att unionens allmänna budget inte ska finansiera nya initiativ på bekostnad av unionens befintliga program och politik. Parlamentet avser att fullgöra sitt åtagande från Efsi-förhandlingarna, dvs. att så långt som möjligt minska konsekvenserna för detta program och öka anslagen för 2019 för de berörda budgetposterna.

6.  Europaparlamentet erinrar om vikten av att främja omfattande synergier mellan FSE:s transportdel och FSE:s digitala del i syfte att maximera den finansiella hävstången för projekt som syftar till att stimulera digitaliseringen av TEN‑T‑korridorerna.

7.  Europaparlamentet betonar vikten av att fullborda energiunionen samtidigt som de europeiska klimatmålen nås genom att uppfylla Parisavtalet och FN:s mål för hållbar utveckling. Parlamentet noterar kraven, i sitt betänkande om att påskynda innovationen för ren energi (2017/2084 (INI)), avseende större samstämmighet mellan unionens åtaganden enligt Parisavtalet och dess finansieringspolitik för de fem ömsesidigt stödjande dimensionerna av energiunionen. Parlamentet påminner i detta sammanhang om den antagna principen om ”energieffektivitet först” och unionens mål att bli världsledande inom förnybar energi. Parlamentet uppmanar kommissionen att tillhandahålla nödvändig finansiering för investeringar på dessa områden samt för hållbar utveckling, ta itu med energifattigdom och rättvis övergång och garantera lika villkor för industrin i processen för att gå över till renare produktionsprocesser i syfte att uppnå en koldioxidsnål ekonomi 2050. Parlamentet välkomnar i detta avseende kommissionens uppskattningar att klimatutgifterna kommer att uppgå till 20,1 % i 2019 års budget, men upprepar att detta förslag kommer att innebära att endast 19,3 % av unionens budget för 2014–2020 går till klimatrelaterade åtgärder. Parlamentet anser att man för att uppnå dessa mål bör bibehålla nödvändiga medel för FSE. Parlamentet är oroat över de betydande nedskärningar som rådet gjort i åtagande- och betalningsbemyndigandena för FSE-energi.

8.  Europaparlamentet är medvetet om vikten av budgetposterna för samhällsutmaningar, särskilt budgetposten för bättre livslång hälsa och välbefinnande, för att höja levnadsstandarden i unionen. Parlamentet uppmuntrar kommissionen att bevara en tillräcklig finansiering för sådana syften och beklagar rådets föreslagna minskningar.

9.  Europaparlamentet understryker vikten av att uppnå målen för den digitala inre marknaden för att öka unionens digitalisering och främja den digitala delaktigheten när det gäller unionens ekonomi, offentliga sektor och medborgare. Parlamentet inser i detta sammanhang vikten av initiativ såsom WIFI4EU. Parlamentet beklagar rådets nedskärningar avseende detta initiativ.

10.  Europaparlamentet betonar att små och medelstora företag är en viktig del av den europeiska ekonomin eftersom de tillhandahåller många arbetstillfällen inom unionen och anser att man bör inrätta ett gynnsamt företagsklimat för små och medelstora företag samt främja kluster och nätverk för små och medelstora företag. Parlamentet noterar dock med djup oro rådets nedskärningar i instrumentet för små och medelstora företag, vilket sänder ett motsägelsefullt budskap till de europeiska företagen.

11.  Europaparlamentet uppmärksammar det europeiska försvarsindustriella utvecklingsprogrammet (EDIDP). Parlamentet betonar att en sådan verksamhet bör förses med nya resurser med hänsyn till dess väsentliga inverkan på unionens budget. Parlamentet oroar sig över rådets nedskärningar av anslagen till FSE och europeiska rymdprogram, så som Ledarskap i rymden och Copernicus, för att finansiera EDIDP, eftersom finansiella medel inte bör tas från civila program för att stödja program på försvarsområdet.

12.  Europaparlamentet understryker behovet av att reformera den europeiska rörlighetssektorn för att åstadkomma hållbara, rena och konkurrenskraftiga transporter i unionen, se till att unionens bilindustri är redo för framtiden och för att uppnå våra klimatmål. Parlamentet betonar därför behovet av tillräcklig finansiering för program som stöder dessa mål, t.ex. FSE-Transport och det gemensamma företaget för bränsleceller och vätgas 2 (FCH 2). Parlamentet är sålunda bekymrat över rådets nedskärningar av anslagen för dessa program.

13.  Europaparlamentet påminner om vikten av tillräckliga ekonomiska resurser och personalresurser för alla byråer som omfattas av ITRE-utskottets ansvarsområde för att säkerställa att de kan fullgöra sina uppgifter. Parlamentet betonar att personalminskningen med 5 % och omplaceringspoolen avslutas med denna allmänna budget och uppmanar kommissionen att avstå från liknande åtgärder i framtiden. Parlamentet insisterar på att resurserna ökas i enlighet med ökningen av de berörda byråernas uppgifter. Parlamentet välkomnar i detta sammanhang personalökningen för Enisa och GSA. Parlamentet noterar med oro att ökningen är otillräcklig, och begär också en personalökning för Acer, för att de ska kunna fullgöra sitt uppdrag, inbegripet behovet av att rekrytera och behålla högt specialiserade experter och planera för framtida roller och ansvarsområden.

14.  Europaparlamentet betonar att eftersom Förenade kungariket har meddelat att man kommer att bidra till budgetarna för 2019 och 2020 förväntas Förenade kungarikets utträde ur unionen inte direkt påverka program som omfattas av ITRE-utskottets ansvarsområde.

15.  Europaparlamentet betonar att om unionen inte uppfyller sina rättsliga och politiska åtaganden i fråga om betalningsbemyndiganden skulle detta allvarligt påverka dess tillförlitlighet och tilliten till att EU-institutionerna är kapabla att fullgöra sin roll. Parlamentet betonar att detta förstärks ytterligare av att unionen närmar sig slutet av den nuvarande fleråriga budgetramen och att genomförandet av de fleråriga programmen därför måste gå framåt snabbare.

INFORMATION OM ANTAGANDET I DET RÅDGIVANDE UTSKOTTET

Antagande

24.9.2018

 

 

 

Slutomröstning: resultat

+:

–:

0:

39

5

4

Slutomröstning: närvarande ledamöter

Bendt Bendtsen, José Blanco López, Jonathan Bullock, Jerzy Buzek, Cristian-Silviu Buşoi, Angelo Ciocca, Jakop Dalunde, Igor Gräzin, Rebecca Harms, Barbara Kappel, Jeppe Kofod, Peter Kouroumbashev, Zdzisław Krasnodębski, Christelle Lechevalier, Janusz Lewandowski, Paloma López Bermejo, Edouard Martin, Tilly Metz, Nadine Morano, Dan Nica, Morten Helveg Petersen, Carolina Punset, Julia Reda, Paul Rübig, Massimiliano Salini, Sven Schulze, Neoklis Sylikiotis, Dario Tamburrano, Evžen Tošenovský, Vladimir Urutchev, Henna Virkkunen, Martina Werner, Lieve Wierinck, Hermann Winkler, Flavio Zanonato, Carlos Zorrinho, Anna Záborská, Pilar del Castillo Vera

Slutomröstning: närvarande suppleanter

Amjad Bashir, Michał Boni, Françoise Grossetête, Benedek Jávor, Werner Langen, Olle Ludvigsson, Marisa Matias, Gesine Meissner, Pavel Telička

Slutomröstning: närvarande suppleanter (art. 200.2)

Bernd Kölmel

SLUTOMRÖSTNING MED NAMNUPPROPI DET RÅDGIVANDE UTSKOTTET

39

+

ALDE

Igor Gräzin, Gesine Meissner, Morten Helveg Petersen, Carolina Punset, Pavel Telička, Lieve Wierinck

ECR

Bernd Kölmel, Zdzisław Krasnodębski, Evžen Tošenovský

EFDD

Dario Tamburrano

PPE

Bendt Bendtsen, Michał Boni, Cristian-Silviu Buşoi, Jerzy Buzek, Pilar del Castillo Vera, Françoise Grossetête, Werner Langen, Janusz Lewandowski, Nadine Morano, Paul Rübig, Massimiliano Salini, Sven Schulze, Vladimir Urutchev, Henna Virkkunen, Hermann Winkler, Anna Záborská

S&D

Jeppe Kofod, Peter Kouroumbashev, Olle Ludvigsson, Edouard Martin, Dan Nica, Martina Werner, Flavio Zanonato, Carlos Zorrinho

VERTS/ALE

Jakop Dalunde, Rebecca Harms, Benedek Jávor, Tilly Metz, Julia Reda

5

-

ECR

Amjad Bashir

EFDD

Jonathan Bullock

ENF

Angelo Ciocca, Christelle Lechevalier

S&D

José Blanco López

4

0

ENF

Barbara Kappel

GUE/NGL

Paloma López Bermejo, Marisa Matias, Neoklis Sylikiotis

Teckenförklaring:

+  :  Ja-röster

-  :  Nej-röster

0  :  Nedlagda röster


YTTRANDE från utskottet för den inre marknaden och konsumentskydd (12.7.2018)

till budgetutskottet

över förslaget till Europeiska unionens allmänna budget för budgetåret 2019

(2018/2046(BUD))

Föredragande av yttrande: Jasenko Selimovic

FÖRSLAG

Utskottet för den inre marknaden och konsumentskydd uppmanar budgetutskottet att som ansvarigt utskott infoga följande förslag i det förslag till resolution som antas:

1.  Europaparlamentet noterar att utskottet för den inre marknaden och konsumentskydd (IMCO-utskottet) under budgetförfarandet ansvarar för budgetposterna i avdelningarna 2 (inre marknaden, industri, entreprenörskap samt små och medelstora företag), 14 (beskattning och tullunionen) och 33 (rättsliga frågor och konsumentskydd).

2.  Europaparlamentet understryker att den inre marknaden är en av EU:s största framgångar. Den har gjort det möjligt för personer, varor, tjänster och kapital att röra sig friare inom unionen, den har ökat EU:s bruttonationalprodukt med 1,7 % och skapat 3,6 miljoner nya arbetstillfällen sedan 1990, och parlamentet anser därför att fullbordandet av den inre marknaden bör förbli en av prioriteringarna i 2019 års budget, eftersom den är av avgörande betydelse för att unionen ska bli en mer konkurrenskraftig och dynamisk kunskapsbaserad ekonomi, vilket gynnar både unionens medborgare och företag. Parlamentet betonar i detta sammanhang behovet av att göra unionen mer konkurrenskraftig och begär ett budgetanslag som stöder omvandlingen till en digital miljö.

3.  Europaparlamentet påminner om att en god och kraftfull konsumentmiljö är en viktig faktor för fullbordandet av den inre marknaden och för den ekonomiska tillväxten i hela Europa och betonar att unionslagstiftningen om konsumentskydd har gett medborgarna och företagen den förutsägbarhet och det förtroende som är nödvändigt på många områden, t.ex. passagerares rättigheter, konsumentskydd och kampen mot otillbörliga affärsmetoder och oskäliga avtalsvillkor.

4.  Europaparlamentet noterar samtidigt att flera skandaler som nyligen inträffat visar att det fortfarande finns osäkra produkter och produkter som inte uppfyller kraven på unionsmarknaden, vilket understryker behovet av budgetmedel för en effektivare och bättre samordnad marknadsövervakning och åtgärder för att säkerställa konsumentsäkerheten.

5.  Europaparlamentet välkomnar att IMCO-utskottets främsta prioriteringar inom tullunionen, konsumentskydd, konkurrens och den inre marknaden för varor och tjänster har beaktats på ett lämpligt sätt i förslaget till Europeiska unionens allmänna budget för budgetåret 2019 (budgetförslaget för 2019) och försetts med tillräckliga budgetanslag när det gäller åtagandebemyndigandena, och uppmanar rådet att bekräfta dessa anslag.

6.  Europaparlamentet betonar att politiken för den inre marknaden bör vara en prioritering inom ramen för insatserna för att bättre utnyttja budgeten, och att motsvarande besparingar bör göras på andra områden för att respektera utgiftsåtagandena.

7.  Europaparlamentet välkomnar ökningen av åtagandebemyndigandena för moderniseringen av tullunionen till stöd för genomförandet av unionens tullkodex och utvecklingen av det elektroniska tullsystemet, eftersom ett fullständigt och enhetligt genomförande av tullkodexen är nödvändigt för ett bättre skydd av medborgarna och unionens ekonomiska intressen, och e-tull utgör den viktigaste utmaningen under de kommande åren för att säkerställa en bättre fungerande inre marknad, och understryker att en förenkling av tullförfarandena och ett effektivt genomförande av tullsystemen är av avgörande betydelse för att bekämpa bedrägeri och stimulera konkurrensen.

8.  Europaparlamentet betonar att utmaningarna i konsumentskyddet för unionsmedborgarna fortfarande finns kvar, särskilt när det gäller den digitala ekonomin och utvecklingen av gränsöverskridande detaljhandel i unionen, och beklagar därför att anslagen för konsumentprogrammet i budgetförslaget för 2019 inte är tillräckliga. Parlamentet efterlyser därför en adekvat finansiering för konsumentprogrammet i syfte att slutföra genomförandet av en verklig digital inre marknad för Europa, säkerställa en hög skyddsnivå för konsumenterna, särskilt utsatta konsumenter, och säkerställa att nya utmaningar för konsumentskyddspolitiken beaktas på lämpligt sätt.

9.  Europaparlamentet betonar vikten av verktyg för styrning av den inre marknaden för att säkerställa inte bara en korrekt tillämpning av unionens regler utan även bättre information och stöd till konsumenter och företag, samt rekommenderar kommissionen att stödja informationsprogram om deras rättigheter och om åtgärder vid kränkningar av dessa. Parlamentet kräver därför en ökning av den relevanta budgetposten 02 03 04 för att säkerställa en bättre fungerande inre marknad och i synnerhet informations- och stödtjänster.

10.  Europaparlamentet noterar att 91,6 % av medborgarna och företagen är omedvetna om de informations- och stödtjänster som finns på EU-nivå(1) och anser att det är av största betydelse att konsumenter och företag känner till informations- och stödverktygen, i synnerhet portalen Ditt Europa och nätverket av europeiska konsumentcentrum, och att det behövs stora insatser för att öka medvetenheten om dessa verktyg och parlamentet förväntar sig därför en betydande ökning av anslagen.

11.  Europaparlamentet noterar att unionens institutioner redan nått en informell överenskommelse om kommissionens förslag till förordning om inrättande av en gemensam digital ingång för tillhandahållande av information, förfaranden samt stöd- och problemlösningstjänster och förväntar sig tillräckliga anslag redan under 2019 för förberedelserna av denna ingång.

12.  Med anledning av ikraftträdandet den 3 december 2018 av Europaparlamentets och rådets förordning (EU) 2018/302(2) påminner Europaparlamentet kommissionen om dess åtagande att senast i mars 2020 utföra en ingående analys av möjligheten att utvidga förordningens tillämpningsområde till att fullt ut omfatta upphovsrättsskyddade tjänster som tillhandahålls på elektronisk väg, inbegripet audiovisuella tjänster, och vill därför se adekvata anslag för detta ändamål redan under 2019.

13.  Europaparlamentet påminner om att programmet för företagens konkurrenskraft och små och medelstora företag (Cosme) är ett viktigt verktyg för att främja företagarandan, stödja befintliga små och medelstora företag och säkerställa deras konkurrenskraft, hållbarhet och tillväxt, hjälpa dem att anpassa sig till den digitala omvandlingen samt gynna utvecklingen av kunskapssamhället, och förväntar sig att en minskning av betalningsbemyndigandena för Cosme i budgetförslaget för 2019 endast görs på grundval av en detaljerad beräkning av utestående belopp som görs av kommissionen, eftersom det är av avgörande betydelse att undvika flaskhalsar och brister i betalningarna för åtgärderna inom Cosmeprogrammet.

14.  Europaparlamentet välkomnar ökningen av åtagandebemyndigandena i budgetförslaget för 2019 under budgetpost 02 02 01 ”Främjande av entreprenörskap och förbättring av konkurrenskraften och marknadstillträdet för företagen i EU”, men har farhågor om nivån på de planerade betalningsbemyndigandena, eftersom en förbättring av små och medelstora företags tillgång till finansiering fortfarande är en viktig prioritering för IMCO-utskottet i 2019 års budget.

15.  Europaparlamentet välkomnar ökningen av anslagen i 2019 års budgetförslag för budgetpost 33 04 01 ”Skydda konsumenternas intressen och förbättra deras säkerhet och information”. Parlamentet påminner om att ökad medvetenhet och bättre utbildning bland konsumenterna är av avgörande betydelse för den digitala inre marknaden. Parlamentet vill se en förstärkning av verktygen för den inre marknaden för att öka medvetenheten om inremarknadsreglerna. Parlamentet betonar vikten av fortsatta ekonomiska anslag till Solvit, nätverket av europeiska informationscentraler för konsumenter och Fin-Net.

16.  Europaparlamentet framhåller betydelsen av standarder för konkurrenskraften på unionsmarknaden. Parlamentet påminner om att det krävs tillräckligt ekonomiskt stöd för det arbete som utförs av de europeiska standardiseringsorganen.

17.  Europaparlamentet begär finansiering för alla de pilotprojekt som godkänts av IMCO‑utskottet och särskilt för de som avser övervakning av eventuell oskälig konsumentprofilering och prisanpassningar som flygbolag ägnar sig åt (för att undersöka om flygbolagen tillämpar så kallad konsumentprofilering i syfte att anpassa flygpriserna), tillämpning av kraven på webbtillgänglighet i webbpubliceringsverktyg och -plattformar per automatik (som främjar och stödjer antagandet av tillgänglighetskraven enligt europeisk standard EN 301 549 V1.1.2 genom att bevilja stöd till företag), och utvärdering av påstådda skillnader i kvalitet hos produkter som säljs på den inre marknaden (som utvecklar ytterligare relevant konsument- och marknadsrelaterad forskning om påstådda kvalitetsskillnader hos produkter på den inre marknaden).

18.  När det gäller pilotprojektet om en utvärdering av påstådda skillnader i kvalitet hos produkter som säljs på den inre marknaden, uppmanar Europaparlamentet kommissionen att förvissa sig om att ledamöterna av IMCO-utskottet är nära involverade i planeringen och övervakningen av all verksamhet med anknytning till detta pilotprojekt och upprepar att ledamöterna bör ha en framträdande roll när det gäller att informera allmänheten om resultaten av den slutliga rapporten.

19.  Europaparlamentet betonar behovet av att koppla alla inremarknadsprogram till Europaparlamentets och rådets förordning (EU) nr 2016/679(3).

INFORMATION OM ANTAGANDET I DET RÅDGIVANDE UTSKOTTET

Antagande

12.7.2018

 

 

 

Slutomröstning: resultat

+:

–:

0:

34

3

0

Slutomröstning: närvarande ledamöter

John Stuart Agnew, Pascal Arimont, Dita Charanzová, Carlos Coelho, Sergio Gaetano Cofferati, Anna Maria Corazza Bildt, Daniel Dalton, Nicola Danti, Dennis de Jong, Pascal Durand, Maria Grapini, Liisa Jaakonsaari, Eva Maydell, Marlene Mizzi, Jiří Pospíšil, Christel Schaldemose, Andreas Schwab, Olga Sehnalová, Jasenko Selimovic, Ivan Štefanec, Catherine Stihler, Richard Sulík, Róża Gräfin von Thun und Hohenstein, Mylène Troszczynski, Mihai Ţurcanu, Anneleen Van Bossuyt, Marco Zullo

Slutomröstning: närvarande suppleanter

Biljana Borzan, Birgit Collin-Langen, Julia Reda, Marc Tarabella, Matthijs van Miltenburg, Sabine Verheyen

Slutomröstning: närvarande suppleanter (art. 200.2)

Asim Ademov, Isabella De Monte, Sylvie Goddyn, Nosheena Mobarik

SLUTOMRÖSTNING MED NAMNUPPROP I DET ANSVARIGA UTSKOTTET

34

+

ALDE

Dita Charanzová, Jasenko Selimovic, Matthijs van Miltenburg

ECR

Daniel Dalton, Nosheena Mobarik, Richard Sulík, Anneleen Van Bossuyt

EFDD

Marco Zullo

GUE/NGL

Dennis de Jong

PPE

Asim Ademov, Pascal Arimont, Carlos Coelho, Birgit Collin-Langen, Anna Maria Corazza-Bildt, Eva Maydell, Jiří Pospíšil, Andreas Schwab, Ivan Stefanec, Róża Gräfin von Thun und Hoheinstein, Mihai Turcanu, Sabine Verheyen

S&D

Biljana Borzan, Sergio Gaetano Cofferati, Nicola Danti, Isabella De Monte, Maria Grapini, Liisa Jaakonsaari, Marlene Mizzi, Christel Schaldemose, Olga Sehnalová, Catherine Stihler, Marc Tarabella

Verts/ALE

Pascal Durand, Julia Reda

3

-

EFDD

John Stuart Agnew

Verts/ALE

Sylvie Goddyn, Mylène Troszczynski

0

0

 

 

Teckenförklaring:

+  :  Ja-röster

-  :  Nej-röster

0  :  Nedlagda röster

(1)

Uppgifter från 2017, Study on information and assistance needs of businesses operating cross-border within the EU, including gap and cost analysis, s. 30.

(2)

Europaparlamentets och rådets förordning (EU) 2018/302 av den 28 februari 2018 om åtgärder mot omotiverad geoblockering och andra former av diskriminering på grund av kundernas nationalitet, bosättningsort eller etableringsort på den inre marknaden och om ändring av förordningarna (EG) nr 2006/2004 och (EU) 2017/2394 och direktiv 2009/22/EG (EUT L 60 I, 2.3.2018, s. 1).

(3)

Europaparlamentets och rådets förordning (EU) nr 2016/679 av den 27 april 2016 om skydd för fysiska personer med avseende på behandling av personuppgifter och om det fria flödet av sådana uppgifter och om upphävande av direktiv 95/46/EG (allmän dataskyddsförordning) (EUT L 119, 4.5.2016, s. 1).


YTTRANDE från utskottet för transport och turism (30.8.2018)

till budgetutskottet

över förslaget till Europeiska unionens allmänna budget för budgetåret 2019

(2018/2046(BUD))

Föredragande av yttrande: Pavel Telička

FÖRSLAG

Utskottet för transport och turism uppmanar budgetutskottet att som ansvarigt utskott infoga följande förslag i det förslag till resolution som antas:

1.  Europaparlamentet noterar förslaget till budget för EU:s transportpolitik under rubrik 1a, avdelning 6 ”Transport och rörlighet”. Parlamentet insisterar på att unionens transportpolitik är av avgörande betydelse för den fria rörligheten för personer och varor, för den globala europeiska integrationen, för den sociala och territoriella sammanhållningen i unionen och för den övergripande konkurrenskraften. Parlamentet betonar därför att denna politik behöver en ambitiös budget för transportsektorn i syfte att bevara trovärdigheten för pågående projekt och garantera ett lämpligt infrastrukturnät som fungerar smidigt samt säkra långsiktiga investeringar som främjar europeiska företag, och mobilisera kompletterande privat finansiering.

2.  Europaparlamentet anser att Fonden för ett sammanlänkat Europa (FSE) är ett mycket viktigt instrument med ett betydande europeiskt mervärde för optimering av transportnätet i hela unionen, genom att ny och befintlig transportinfrastruktur sammanlänkas och/eller moderniseras. Parlamentet betonar den avgörande roll som FSE spelar i transportsektorn för slutförandet av TEN-T:s stomnät och övergripande nät, och påpekar att för en långsiktig planering kräver FSE en stabil och tillräcklig finansiering. Parlamentet beklagar att tidigare budgetnedskärningar har gjorts på bekostnad av FSE och accepterar inte några ytterligare nedskärningar av detta program. Parlamentet noterar att kommissionen föreslår en ökning på 39,4 % respektive 5,3 % av åtagandena och betalningarna för FSE-Transport. Med tanke på att 2019 är det första året av den nuvarande fleråriga budgetramen då ytterligare finansiering kan sökas för projekt som inleddes mellan 2014 och 2016 är dessa belopp ett minimum.

3.  Europaparlamentet välkomnar att ett belopp på 1,7 miljarder EUR under 2019 har omfördelats från Sammanhållningsfonden till FSE:s transportprogram. Dessa medel är öronmärkta uteslutande för TEN-T-infrastrukturprojekt i de medlemsstater som är berättigade till stöd från Sammanhållningsfonden.

4.  Europaparlamentet betonar att Rail Baltica-projektet, som bygger på europeisk spårvidd, är ett av de viktigaste järnvägsprojekten i unionen, men att den finansiering som föreslås är otillräcklig. Kommissionen uppmanas därför att se till att unionens finansiering upprätthålls på samma oförändrade nivå.

5.  Europaparlamentet välkomnar att en ny ansökningsomgång för FSE-Transport inleddes i maj 2018 för att stödja de politiska riktlinjerna för det tredje paketet om ren rörlighet i städer och att ytterligare ansökningsomgångar kommer att utlysas under 2019. Parlamentet påminner om framgången för 2017 års ansökningsomgång om blandad finansiering och uppmanar med eftertryck kommissionen att upprepa en sådan ansökningsomgång för 2019. Parlamentet betonar även i år vikten av att säkerställa komplementaritet mellan FSE och andra fonder, särskilt Efsi, för att maximera unionens mervärde i samband med projektfinansiering och mobilisera ytterligare privata investeringar i storskalig innovation såsom det europeiska trafikstyrningssystemet för tåg (ERTMS) och digitala förbättringar. Samtidigt påminner parlamentet om att finansiella bidrag inom ramen för FSE:s transportdel även i fortsättningen ska vara det huvudsakliga instrumentet för att finansiera hållbara infrastrukturprojekt och gränsöverskridande projekt längs TEN-T-korridorerna.

6.  Europaparlamentet påminner om förpliktelserna enligt Parisavtalet. Parlamentet påpekar att EU inom en nära framtid kommer att ställas inför ökande utmaningar i samband med transporter, såsom begränsning av klimatförändringar och ökande efterfrågan på godstransporter, vilket kommer att kräva energiomställning och nya former av rörlighet. Sådana utmaningar kommer att behöva tillräcklig finansiering för att Europa ska förbli inkluderande och konkurrenskraftigt. Parlamentet betonar därför den grundläggande betydelsen av att stödja och anslå tillräckliga medel för trafikomställning för att förverkliga ett gemensamt europeiskt järnvägsområde med låga koldioxidutsläpp, t.ex. genom införandet av ERTMS, godstransporter på järnväg, höghastighetståg, gränsöverskridande järnvägsförbindelser för att främja motorvägar till sjöss och på inre vattenvägar, inbegripet färjor med låga utsläpp, i syfte att åstadkomma en hållbar transportsektor. Parlamentet understryker dessutom att en effektiv miljöanpassad logistikförvaltning inom alla transportsätt i unionen i stor utsträckning kan bidra till att minska trafikstörningarna och minska koldioxidutsläppen och uppmanar med eftertryck kommissionen att främja digitalisering inom logistiken.

7.  Europaparlamentet påminner om vikten av att främja omfattande synergier mellan FSE:s transportdel och FSE:s digitala del i syfte att maximera den finansiella hävstången för projekt som syftar till att stimulera digitaliseringen av TEN-T-korridorerna.

8.  Europaparlamentet anser att bidraget från EU-budgeten till transportrelaterade byråer bör återspegla deras uppgifter. Parlamentet noterar att den budget som anslagits för Easa är stabil, att budgeten för Emsa har ökat något och att den anslagna budgeten för ERA tyvärr har minskat jämfört med det föregående budgetåret. Parlamentet påminner om att behörighetsområdet för ERA, Easa och Emsa nyligen har utvidgats, vilket kräver en lämplig och tillräcklig finansiering och personal för att säkerställa att de kan klara av sina nya ansvarsområden. I detta avseende påminner parlamentet om att Easa, sedan dess reviderade grundförordning antogs, har fått ett betydligt utökat mandat med nya behörigheter såsom drönare, flygledningstjänst/flygtrafiktjänster, miljö, it-säkerhet, forskning och internationell närvaro, och att budgetförslaget för Easa därför bör utökas när det gäller mänskliga och finansiella resurser, så att Easa får tillräckliga resurser för att upprätthålla en hög säkerhetsnivå för unionens medborgare.

9.  Europaparlamentet påminner om att rymden är en strategisk sektor för unionen, att Galileo och Egnos används i stor utsträckning i transportsektorn och att Egnos har varit fullt operativt sedan 2011, till gagn för alla transportsätt. Parlamentet betonar att Galileo helt och hållet finansieras av EU-budgeten och att när systemet har tagits fullständigt i bruk kommer det att innebära stora fördelar för EU:s ekonomi, eftersom verkliga tjänster kommer att tillhandahållas unionens företag och medborgare. Parlamentet noterar att Galileo för närvarande har 22 satelliter i drift och att systemet bör ha tagits fullständigt i bruk 2020 när dess 30 satelliter kommer att befinna sig i omloppsbana. Parlamentet anser därför, och med hänsyn till den akuta utmaningen för it-säkerheten, att det är av yttersta vikt att en lämplig budget anslås för att säkra kommande satellituppskjutningar. Parlamentet framhåller att Europeiska byrån för GNSS har mycket viktiga uppgifter när det gäller Galileo och Egnos. Parlamentet anser att Europeiska byrån för GNSS måste få tillräckligt med personal för att säkerställa en smidig drift och ett gynnsamt utnyttjande av GNSS-programmen.

10.  Europaparlamentet anser att en förbättrad effektivitet i transportsektorn och minskade utsläpp från sektorn är av varandra beroende mål som forskning och innovation i hög grad kan bidra till att nå i samverkan med relevanta EU-byråer. Parlamentet noterar förslaget om stabilitet i den budget som anslagits inom ramen för programmet Horisont 2020 till Sesar 2 (både för FoU och för genomförandet av systemet för flygledningstjänst (ATM)), Shift2Rail, Clean Sky 2 och det gemensamma företaget för bränsleceller och vätgas 2, samtidigt som det framhåller att det är viktigt att se till att det finns tillräcklig finansiering för att dessa program ska lyckas.

11.  Europaparlamentet anser att unionens finansiering av transportinfrastruktur bör ta hänsyn till följande aspekter:

- interkonnektivitet mellan korridorerna och det övergripande nätet och de gränsöverskridande förbindelserna,

- intermodalitet som grund för beslut om projekt,

- kompatibilitet som ett villkor för medfinansiering av transportprojekt,

- kvalitet på samfinansierade projekt snarare än kvantitet eller storlek,

- medborgardeltagande i ett transparent beslutsfattande och i övervakningen av utvecklingen av stora projekt som uppgår till över 1 miljard EUR i totala investeringar.

12.  Europaparlamentet beklagar att unionen inte alltid är framgångsrik när det gäller kommunikationen om de direkta effekterna av sin politik och sina finansiella program, och att det ofta saknas en bedömning av dessa effekter. Parlamentet påpekar att den allmänna bristen på medvetenhet om passagerares rättigheter i unionen när det gäller transportsektorn är mycket oroande och beklagar att dessa förordningar, särskilt inom luftfarts- eller järnvägssektorn, inte alltid tillämpas konsekvent i alla medlemsstater. Parlamentet understryker att vid en tidpunkt då det är lätt att bedriva desinformationskampanjer måste det anslås mer stöd till denna fråga.

13.  Europaparlamentet betonar att pilotprojekt och förberedande åtgärder är värdefulla möjligheter för parlamentet att ge ett direkt ekonomiskt incitament till initiativ som stöder dess lagstiftningsarbete och för vilka kommissionen är direkt ansvarig. Parlamentet beklagar att resultaten av dessa projekt och åtgärder inte alltid rapporteras konsekvent och uppmanar kommissionen att innan dess mandat löper ut lägga fram en grundlig analys av de projekt som finansierats under denna valperiod samt riktlinjer som redogör inte bara för målen utan också för urvalsmetoderna.

INFORMATION OM ANTAGANDET I DET RÅDGIVANDE UTSKOTTET

Antagande

29.8.2018

 

 

 

Slutomröstning: resultat

+:

–:

0:

33

0

3

Slutomröstning: närvarande ledamöter

Daniela Aiuto, Lucy Anderson, Inés Ayala Sender, Georges Bach, Izaskun Bilbao Barandica, Deirdre Clune, Michael Cramer, Ismail Ertug, Jacqueline Foster, Dieter-Lebrecht Koch, Miltiadis Kyrkos, Bogusław Liberadzki, Peter Lundgren, Marian-Jean Marinescu, Georg Mayer, Markus Pieper, Gabriele Preuß, Christine Revault d’Allonnes Bonnefoy, Dominique Riquet, Massimiliano Salini, Claudia Schmidt, Keith Taylor, Pavel Telička, István Ujhelyi, Wim van de Camp, Elissavet Vozemberg-Vrionidi, Janusz Zemke, Kosma Złotowski, Elżbieta Katarzyna Łukacijewska

Slutomröstning: närvarande suppleanter

Jakop Dalunde, Markus Ferber, Maria Grapini, Karoline Graswander-Hainz, Matthijs van Miltenburg, Henna Virkkunen

Slutomröstning: närvarande suppleanter (art. 200.2)

Anna Hedh

SLUTOMRÖSTNING MED NAMNUPPROP I DET RÅDGIVANDE UTSKOTTET

33

+

ALDE

Izaskun Bilbao Barandica, Matthijs van Miltenburg, Dominique Riquet, Pavel Telička

ECR

Kosma Złotowski

ENF

Georg Mayer

PPE

Georges Bach, Wim van de Camp, Deirdre Clune, Markus Ferber, Dieter-Lebrecht Koch, Elżbieta Katarzyna Łukacijewska, Marian-Jean Marinescu, Markus Pieper, Massimiliano Salini, Claudia Schmidt, Henna Virkkunen, Elissavet Vozemberg-Vrionidi

S&D

Lucy Anderson, Inés Ayala Sender, Ismail Ertug, Maria Grapini, Karoline Graswander-Hainz, Anna Hedh, Miltiadis Kyrkos, Bogusław Liberadzki, Gabriele Preuß, Christine Revault d'Allonnes Bonnefoy, István Ujhelyi, Janusz Zemke

VERTS/ALE

Michael Cramer, Jakop Dalunde, Keith Taylor

0

-

 

 

3

0

ECR

Jacqueline Foster, Peter Lundgren

EFDD

Daniela Aiuto

Teckenförklaring:

+  :  Ja-röster

-  :  Nej-röster

0  :  Nedlagda röster


YTTRANDE från utskottet för regional utveckling (4.9.2018)

till budgetutskottet

över förslaget till Europeiska unionens allmänna budget för budgetåret 2019

(2018/2046(BUD))

Föredragande av yttrande: Derek Vaughan

FÖRSLAG

Utskottet för regional utveckling uppmanar budgetutskottet att som ansvarigt utskott infoga följande förslag i det förslag till resolution som antas:

1.  Europaparlamentet understryker betydelsen av sammanhållningspolitiken som unionens främsta investeringspolitik, som bidrar till att minska de ekonomiska, sociala och territoriella skillnaderna mellan och inom EU:s regioner och till att förhindra att områden släpar efter, främjar en smart och hållbar ekonomisk tillväxt för alla, skapar nya arbetstillfällen och bekämpar arbetslösheten, förbättrar de små och medelstora företagens konkurrenskraft och tillträde till globala marknader, främjar innovation i stads- och landsbygdsområden och uppmuntrar de lokala och regionala myndigheterna att gå över till en neutral ekonomi. Parlamentet konstaterar att varje euro som investeras i sammanhållningspolitiken ger en påvisad avkastning på 174 %(1), och att mindre investeringar skulle innebära lägre tillväxt och färre arbetstillfällen för medborgarna. Parlamentet betonar att sammanhållningspolitiken gagnar alla medlemsstater. Parlamentet kräver att sammanhållningsfonderna bevarar sin roll som EU:s primära investeringspolitik med en budget som står i proportion till de ambitiösa målen för sammanhållningspolitiken.

2.  Europaparlamentet påminner om att sammanhållningspolitiken är ett av de viktigaste instrumenten för att ta itu med de viktigaste prioriteringarna i kommissionens budgetförslag för 2019, dvs. att bygga en starkare och mer motståndskraftig europeisk ekonomi, minska skillnaderna inom EU, skapa arbetstillfällen, säkerställa solidaritet och säkerhet inom och utanför EU:s gränser och se till att EU:s budget genomförs på ett korrekt sätt. Parlamentet betonar i detta avseende vikten av de åtaganden som gjorts inom ramen för Parisavtalet och uppfyllandet av EU:s klimat- och energimål. Parlamentet betonar vikten av att göra EU:s medel mer synliga och bättre förmedla resultaten av sammanhållningspolitiken. Parlamentet uppmanar kommissionen att tillsammans med medlemsstaterna öka medvetenheten om de olika investeringsmöjligheter som EU erbjuder, lyfta fram innovativa projekt och dela med sig av god praxis.

3.  Europaparlamentet noterar med tillfredsställelse att genomförandet av de nuvarande programmen, efter ett underutnyttjande under de första åren av perioden 2014–2020, nu har nått sin marschfart och att genomförandet av betalningar och projekturval har förbättrats. Parlamentet påpekar att de förseningar som registrerats i början av programperioden kan leda till en eftersläpning i handläggningen av betalningsansökningarna under 2019. Parlamentet noterar de ansträngningar som gjorts av kommissionen för att förhindra uppkomsten av onödiga eftersläpningar. Parlamentet betonar i detta avseende att betalningsbemyndigandena måste vara tillräckliga för att genomförandet ska kunna ske på ett smidigt sätt. Europaparlamentet uppmanar kommissionen, med hänsyn till att vissa medlemsstater, enligt de senaste rapporterna om utbetalningar uppdelat per medlemsstat, uppvisar ganska stora förseningar när det gäller utbetalda anslag, att undersöka bristerna och vidta åtgärder för att förbättra utnyttjandet av anslagen från ESI-fonderna.

4.  Europaparlamentet noterar den föreslagna ökningen på 1,1 % av betalningsbemyndigandena, med minskningar på 8,9 % och 3,6 % för Sammanhållningsfonden och till det europeiska territoriella samarbetet, liksom ökningen på 2,8 % av åtagandebemyndigandena under rubrik 1b i budgetförslaget för 2019 jämfört med föregående års budget. Parlamentet är oroat över att dessa belopp kanske inte är tillräckliga för att matcha tempot i genomförandet av programmen under denna rubrik och för att förhindra en eftersläpning av obetalda fordringar, vilket skulle undergräva sammanhållningspolitikens trovärdighet. Parlamentet betonar därför behovet av ökade betalningsbemyndiganden för att visa att unionen kan uppfylla sina åtaganden och därmed upprätthålla sin trovärdighet.

5.  Europaparlamentet påminner kommissionen om förseningarna i förbindelse med utnämningen av nationella förvaltningsmyndigheter. Parlamentet påpekar att det per den 31 maj 2018 återstår att utse nationella myndigheter i förbindelse med 16 program. Parlamentet uppmanar kommissionen och medlemsstaterna att samarbeta aktivt för att slutföra urvalsprocessen så snart som möjligt i syfte att säkerställa ett smidigt genomförande av de nuvarande programmen. Parlamentet uppmanar medlemsstaterna att anstränga sig för att öka absorptionsförmågan och påskynda genomförandet av projekt, för att minska förseningarna till följd av den ofullständiga finansieringen av sammanhållningen under det innevarande budgetåret. Parlamentet betonar på nytt behovet av att förbättra genomförandet av fonderna och av att minska den administrativa bördan, och uppmanar medlemsstaterna att närmare samarbeta med kommissionens arbetsgrupp för att säkra ett bättre genomförande och därmed förbättra förvaltningen av finansieringen av sammanhållningen.

6.  Europaparlamentet noterar förslaget att öka budgeten för stödprogrammet för strukturreformer med 80 miljoner euro för 2019–2020, varav 40 miljoner euro i budgetförslaget för 2019, vilket innebär att den totala budgeten för stödprogrammet för strukturreformer uppgår till 222,8 miljoner euro. Parlamentet anser att ökningen bör finansieras genom utnyttjande av det särskilda instrumentet och utan några kostnader för sammanhållningspolitiken. Parlamentet uppmanar kommissionen att söka efter ytterligare synergier och komplementaritet med ESI-fonderna och andra EU-program för forskning, innovation och konkurrenskraft, såsom Horisont, till exempel i syfte att främja innovation och digitalisering i landsbygdsområden och landsbygdsekonomier.

7.  Europaparlamentet noterar de oerhört positiva effekter som sammanhållningsfonderna har i konfliktområden, däribland Peace-programmet i Nordirland. Parlamentet uppmanar kommissionen och medlemsstaterna att fortsätta att stödja fredsprocessen genom fortsatta anslag till vissa specifika program såsom Peace-programmet, enligt villkor som ska fastställas och utan att det påverkar pågående förhandlingar. Parlamentet betonar att medel från de europeiska programmen för territoriellt samarbete, dvs. för gränsöverskridande samarbete om unionens yttre gränser, också kan gagna utvidgningspolitiken.

INFORMATION OM ANTAGANDET I DET RÅDGIVANDE UTSKOTTET

Antagande

3.9.2018

 

 

 

Slutomröstning: resultat

+:

–:

0:

23

0

0

Slutomröstning: närvarande ledamöter

Pascal Arimont, Mercedes Bresso, Aleksander Gabelic, Michela Giuffrida, Ivan Jakovčić, Louis-Joseph Manscour, Iskra Mihaylova, Andrey Novakov, Younous Omarjee, Mirosław Piotrowski, Liliana Rodrigues, Ruža Tomašić, Ramón Luis Valcárcel Siso, Monika Vana, Matthijs van Miltenburg, Lambert van Nistelrooij, Derek Vaughan, Kerstin Westphal

Slutomröstning: närvarande suppleanter

Daniel Buda, Raffaele Fitto, Elsi Katainen, Tonino Picula, Maria Gabriela Zoană

SLUTOMRÖSTNING MED NAMNUPPROP I DET RÅDGIVANDE UTSKOTTET

23

+

ALDE

Ivan Jakovčić, Elsi Katainen, Iskra Mihaylova, Matthijs van Miltenburg

ECR

Raffaele Fitto, Mirosław Piotrowski, Ruža Tomašić

GUE/NGL

Younous Omarjee

PPE

Pascal Arimont, Daniel Buda, Lambert van Nistelrooij, Andrey Novakov, Ramón Luis Valcárcel Siso

S&D

Mercedes Bresso, Aleksander Gabelic, Michela Giuffrida, Louis-Joseph Manscour, Tonino Picula, Liliana Rodrigues, Derek Vaughan, Kerstin Westphal, Maria Gabriela Zoană

VERTS/ALE

Monika Vana

0

-

 

 

0

0

 

 

Teckenförklaring:

+  :  Ja-röster

-  :  Nej-röster

0  :  Nedlagda röster

(1)

Kommissionens arbetsdokument av den 19 september 2016 Ex post evaluation of the ERDF and Cohesion Fund 2007-13 SWD(2016)0318.


YTTRANDE från utskottet för jordbruk och landsbygdens utveckling (30.8.2018)

till budgetutskottet

över förslaget till Europeiska unionens allmänna budget för budgetåret 2019

(2018/2046(BUD))

Föredragande av yttrande: Ramón Luis Valcárcel Siso

FÖRSLAG

Utskottet för jordbruk och landsbygdens utveckling uppmanar budgetutskottet att som ansvarigt utskott infoga följande förslag i det förslag till resolution som antas:

1.  Europaparlamentet välkomnar de belopp på 60 miljarder EUR i åtagandebemyndiganden respektive 57,8 miljarder EUR i betalningsbemyndiganden som kommissionen föreslår för rubrik 2 i förslaget till budget 2019, vilket jämfört med 2018 års budget innebär en ökning med 1,2 % respektive 3,0 %. Parlamentet konstaterar emellertid att när det gäller EGFJ är denna ökning en följd av det lägre belopp för inkomster avsatta för särskilda ändamål som beräknas finnas tillgängliga för EGFJ i budgetförslaget för 2019 jämfört med 2018 års budget. Parlamentet rekommenderar att allt görs för att undvika en ackumulering av eftersläpande betalningar under nästa fleråriga budgetram (2021–2027).

2.  Europaparlamentet insisterar på att medel måste tillhandahållas för att kompensera för de ekonomiska förluster som jordbrukarna drabbas av till följd av marknadskriser, liksom sanitära kriser eller fytosanitära kriser, såsom Xylella fastidiosa, och upprepar att det är nödvändigt att använda de tillgängliga marginalerna under rubrik 2 i kombination med rubrik 3 för detta ändamål. Parlamentet insisterar på att kompensation för utrotningsåtgärder också bör omfatta återupprättandet av jordbruksekosystemen, inbegripet marken, liksom upprättande av en solid biologisk mångfald, särskilt genom att säkra genetisk mångfald i växtbeståndet, vilket helst bör omfatta resistens mot eller tolerans av sjukdomar och skadedjur. Parlamentet anser att ett av målen med stödet bör vara att säkerställa balanserade jordbruksekosystem och landskap präglade av biologisk mångfaldig, som är mindre känsliga för framtida angrepp.

3.  Europaparlamentet insisterar på att alla inkomster i unionens budget från eventuella inkomster avsatta för särskilda ändamål eller återbetalningar till följd av oegentligheter på jordbruksområdet bör bibehållas inom rubrik 2.

4.  Europaparlamentet begär att ytterligare medel ska öronmärkas för olivodlings- och olivoljesektorn i syfte att kompensera för de förluster som utbrottet av Xylella fastidiosa har orsakat jordbrukarna, stärka de förebyggande åtgärderna i Europa och omstrukturera sektorn och konsolidera den vetenskapliga forskningen om patogenen och dess vektorer.

5.  Europaparlamentet uppmanar kommissionen och medlemsstaterna att regelbundet övervaka prisvolatiliteten på jordbruksprodukter, vilken inverkar negativt på jordbrukarnas inkomster, och att snabbt och effektivt vidta åtgärder när detta är nödvändigt.

6.  Europaparlamentet betonar att det är mycket viktigt att medel som har öronmärkts för forskning inom jordbrukets livsmedelssektor, särskilt från Horisont 2020-budgeten, till fullo förblir tillgängliga för detta ändamål, i syfte att stimulera och stärka innovation och smarta lösningar inom jordbruket och landsbygdens utveckling, såsom de anslag som kommer från Fonden för ett sammanlänkat Europa (FSE) för att möjliggöra installation av bredband på landsbygden. Parlamentet understryker vikten av praktisk tillämpning av resultaten på gårdsnivå och den roll som rådgivningsverksamheten för lantbruket kan spela. Parlamentet noterar att integrerade ”smarta” lösningar, såsom smarta byar, precisionsjordbruk, digitalisering, delningsekonomi, cirkulär ekonomi och sociala initiativ, kan bidra till jordbruket och det övergripande välståndet på landsbygden. Parlamentet uppmanar kommissionen att planera en reserv för ”smarta” strategier i ljuset av reformen av den gemensamma jordbrukspolitiken och Cork 2.0-deklarationen. Parlamentet betonar att dessa ”smarta” lösningar bör vara förenliga med mål avseende miljö, klimat och biologisk mångfald, och säkerställa ett nära samarbete med relevanta intressenter från alla medlemsstater. Parlamentet betonar vikten av investeringar i precisionsjordbruk i syfte att effektivisera produktionsmetoder och minska förlusterna och uppmuntra och stödja initiativ som är skräddarsydda för behoven hos små jordbruksföretag som saknar stordriftsfördelar, så att de kan dra nytta av ny teknik.

7.  Europaparlamentet betonar att lagerhållningsprogram har visat sig effektiva i kristider, och att det därför vore kontraproduktivt att minska de medel som öronmärkts för dessa i planeringsprocessen.

8.  Europaparlamentet beklagar de aviserade nedskärningarna av budgeten för den gemensamma jordbrukspolitiken i kommissionens förslag om den fleråriga budgetramen. Parlamentet påpekar särskilt att jordbrukspolitiken är en gemensam politik och att alla nedskärningar av budgeten för den gemensamma jordbrukspolitiken skulle få oproportionerliga effekter, eftersom de inte kan ersättas med nationella medel på grund av bestämmelserna om statligt stöd.

9.  Europaparlamentet välkomnar den anslagsökning som kommissionen föreslår för producentorganisationer inom frukt- och grönsakssektorn, och betonar att dessa i allt högre grad bidrar till att jämna ut förhandlingspositionerna i livsmedelsförsörjningskedjan, och betonar fortsatt behovet av att finansiera åtgärder för att höja anslutningsgraden bland jordbruksproducenterna.

10.  Europaparlamentet betonar vikten av att fastställa stödåtgärder för att konsolidera jordbrukarnas roll i försörjningskedjan och hitta nya metoder för att främja lantbruksorganisationer.

11.  Europaparlamentet beklagar att stödåtgärderna avseende det ryska embargot inte har förlängts med tanke på att många producenter inom unionen, särskilt inom mjölk- och frukt- och grönsakssektron, fortfarande påverkas negativt, utan egen förskyllan, eftersom jordbrukarna inte kan hållas ansvariga för unionens diplomatiska politik. Parlamentet begär därför att stödåtgärderna för jordbruksproducenterna ska bibehållas på nuvarande nivå i de fall där det fortfarande förekommer svårigheter på marknaden på grund av det ryska förbudet. Parlamentet begär dessutom att det inrättas en ny krisreserv, vars finansiering inte bygger på en mekanism för årlig budgetdisciplin, så att man i god tid kan reagera på krissituationer som uppstår. Parlamentet inser att vissa medlemsstater som inte hade handelsförbindelser med Ryssland indirekt påverkades av embargot, och betonar att stödet också måste täcka förluster till följd av översvämningen av marknaderna med produkter avsedda för den ryska marknaden.

12.  Europaparlamentet välkomnar den ökade finansiering som kommissionen föreslår för säljfrämjande åtgärder, något som bekräftar att de förbättringar som gjorts i samband med den senaste reformen varit effektiva. Parlamentet anser att säljfrämjande åtgärder är av avgörande betydelse för att öka den europeiska exportens marknadsandelar globalt och för att hantera de restriktioner som vissa tredjeländer infört för produkter från unionen, såsom det ryska embargot eller det senaste amerikanska beslutet att införa antidumpnings- och utjämningstullar på import av spanska mogna oliver.

13.  Europaparlamentet pekar på följderna av den extrema torka som drabbat medlemsstaterna under de senaste månaderna och som orsakar betydande förluster för jordbruket och äventyrar ett stort antal jordbruk, och betonar i detta sammanhang behovet av att garantera särskilda stödåtgärder i syfte att bistå de värst drabbade jordbrukarna.

14.  Europaparlamentet välkomnar kommissionens åtagande att bibehålla den nuvarande finansieringsnivån inom biodlingssektorn, vilket är avgörande för att bidra till att täcka utgifterna för de nationella programmen.

15.  Europaparlamentet välkomnar de ökade anslagen till forskning och utveckling med anknytning till jordbruket inom ramen för Horisont 2020.

16.  Europaparlamentet varnar för att ett frihandelsavtal med Mercosur som inte ger tillräckligt skydd för känsliga sektorer inom unionens jordbruk kommer att innebära ytterligare ekonomiska påfrestningar för många europeiska producenter.

17.  Europaparlamentet anser att unionen kan lämna ett avgörande bidrag till främjandet av hälsosamma matvanor som bygger på hållbar produktion, i synnerhet bland barn, och anser därför att det är nödvändigt att till fullo utnyttja de tak som fastställts för unionens skolprogram i den nuvarande förordningen. Parlamentet uppmanar därför medlemsstaterna att stärka sina nationella program för att säkra att de högsta tillgängliga anslagen utnyttjas fullt ut (250 miljoner EUR för unionen).

18.  Europaparlamentet noterar de överföringar från pelare I till pelare II som Frankrike, Litauen och Nederländerna nyligen beslutat om, vilket har lett till en minskning av anslagen för direktstöd i 2019 års budgetförslag.

19.  Europaparlamentet bekräftar på nytt vikten av programmet för frukt och grönsaker i skolan, i synnerhet med hänsyn till den nuvarande nivån på undernäring bland barn inom unionen. Parlamentet uppmanar därför kommissionen att minska den byråkrati som hänger samman med programmet, och betonar behovet av att främja hälsosamma matvanor bland barn, liksom konsumtion av ekologiskt odlade frukter och grönsaker.

20.  Europaparlamentet beklagar att betalningarna till unga jordbrukare inte genomförts i tillräckligt hög grad under de senaste åren, och uppmanar medlemsstaterna att främja utnyttjandet av dessa anslag under följande år för att stödja generationsskiften och undvika koncentration av jordbruksmark och markrofferi. Parlamentet påpekar att bristen på arbetskraft inom jordbruket hämmar utvecklingen av jordbrukssektorn, och understryker behovet av stödåtgärder för att locka arbetstagare till jordbrukssektorn.

21.  Europaparlamentet betonar vikten av åtaganden och utgifter till förmån för landsbygdens utveckling och deras potential för skapandet av näringsverksamhet och arbetstillfällen, särskilt i perifera områden med högre arbetslöshet, och särskilt för de yngre generationerna. Parlamentet insisterar på att man bör bibehålla de initiativ som vänder sig till unga jordbrukare, bland annat regionalt anpassade program, som skulle ge stöd till innovation och det nödvändiga generationsskiftet. Parlamentet anser att stödet till ungdomar bör inriktas på deras nuvarande behov snarare än på att försöka få dem att skuldsätta sig orimligt mycket.

22.  Europaparlamentet konstaterar att tillgången till instrument för jordbruksinvesteringar bör anpassas bättre till nya jordbrukares investeringsbehov och riskprofiler.

23.  Europaparlamentet begär att anslagen för Poseiprogrammen ska bibehållas på de maximala nivåer som fastställs i den berörda unionsförordningen, och understryker hur viktiga dessa program är för jordbruksproducenternas motståndskraft, samt uppmärksammar den bräckliga ekonomiska situationen i de yttersta randområdena, som fortfarande är hårt drabbade av krisen och de strukturella nackdelar som avses i artikel 349 i EUF-fördraget (avlägsen belägenhet, ökaraktär, ringa storlek, besvärliga terräng- och klimatförhållanden samt ekonomiskt beroende av ett fåtal produkter).

24.  Europaparlamentet understryker vikten av pilotprojekt och förberedande åtgärder för innovation inom jordbruks- och landsbygdsutvecklingssektorerna. Parlamentet begär ett fortsatt stöd till pågående och nya pilotprojekt och förberedande åtgärder.

25.  Europaparlamentet uttrycker djup oro över de nedskärningar av anslagen för den gemensamma jordbrukspolitiken som planeras i kommissionens förslag för 2021–2027, särskilt för de yttersta randområdena och för Poseiprogrammen.

26.  Europaparlamentet beklagar den betydande minskningen av budgetposten för systemet med frivilligt kopplat stöd, med tanke på att kopplade stöd är ett viktigt verktyg för att bevara grödor som uppvisar flera fördelar för jordbruket och miljön.

27.  Europaparlamentet uttrycker sin tillfredsställelse över ökningen på 25 % av anslagen för bekämpning av djursjukdomar och skadegörare på växter, eftersom unionen brottas med betydande risker och ökade utbrott.

INFORMATION OM ANTAGANDET I DET RÅDGIVANDE UTSKOTTET

Antagande

29.8.2018

 

 

 

Slutomröstning: resultat

+:

–:

0:

36

2

3

Slutomröstning: närvarande ledamöter

John Stuart Agnew, Clara Eugenia Aguilera García, Eric Andrieu, Daniel Buda, Jacques Colombier, Michel Dantin, Albert Deß, Jørn Dohrmann, Herbert Dorfmann, Luke Ming Flanagan, Karine Gloanec Maurin, Martin Häusling, Anja Hazekamp, Esther Herranz García, Jan Huitema, Ivan Jakovčić, Jarosław Kalinowski, Zbigniew Kuźmiuk, Norbert Lins, Philippe Loiseau, Mairead McGuinness, Giulia Moi, Ulrike Müller, James Nicholson, Maria Noichl, Marijana Petir, Laurenţiu Rebega, Bronis Ropė, Maria Lidia Senra Rodríguez, Ricardo Serrão Santos, Czesław Adam Siekierski, Tibor Szanyi, Maria Gabriela Zoană, Marco Zullo

Slutomröstning: närvarande suppleanter

Franc Bogovič, Michela Giuffrida, Karin Kadenbach, Elsi Katainen, Momchil Nekov, Annie Schreijer-Pierik, Ramón Luis Valcárcel Siso

SLUTOMRÖSTNING MED NAMNUPPROP I DET RÅDGIVANDE UTSKOTTET

36

+

ALDE

Ivan Jakovčić, Elsi Katainen, Ulrike Müller

ECR

Jørn Dohrmann, Zbigniew Kuźmiuk, James Nicholson, Laurenţiu Rebega

EFDD

Giulia Moi, Marco Zullo

ENF

Jacques Colombier, Philippe Loiseau

PPE

Franc Bogovič, Daniel Buda, Michel Dantin, Albert Deß, Herbert Dorfmann, Esther Herranz García, Jarosław Kalinowski, Norbert Lins, Mairead McGuinness, Marijana Petir, Annie Schreijer‑Pierik, Czesław Adam Siekierski, Ramón Luis Valcárcel Siso

S&D

Clara Eugenia Aguilera García, Eric Andrieu, Michela Giuffrida, Karine Gloanec Maurin, Karin Kadenbach, Momchil Nekov, Maria Noichl, Ricardo Serrão Santos, Tibor Szanyi, Maria Gabriela Zoană

Verts/ALE

Martin Häusling, Bronis Ropė

2

-

EFDD

John Stuart Agnew

GUE/NGL

Anja Hazekamp

3

0

ALDE

Jan Huitema

GUE/NGL

Luke Ming Flanagan, Maria Lidia Senra Rodríguez

Teckenförklaring:

+  :  Ja-röster

-  :  Nej-röster

0  :  Nedlagda röster


YTTRANDE från fiskeriutskottet (31.8.2018)

till budgetutskottet

över förslaget till Europeiska unionens allmänna budget för budgetåret 2019

(2018/2046(BUD))

Föredragande av yttrande: Alain Cadec

FÖRSLAG

Fiskeriutskottet uppmanar budgetutskottet att som ansvarigt utskott infoga följande förslag i det förslag till resolution som antas:

A. De finansiella resurserna för den gemensamma fiskeripolitiken och de obligatoriska avgifterna till de regionala fiskeriförvaltningsorganisationerna och andra internationella organisationer och till avtal om hållbart fiske är koncentrerade till avsnitt III och avdelning 11, Havsfrågor och fiske, Europeiska havs- och fiskerifonden (EHFF) i budgeten.

B. Den gemensamma fiskeripolitikens centrala mål är att skapa balans avseende hållbarheten inom en strategisk ekonomisk sektor för unionen – en sektor som bidrar till livsmedelsförsörjningen, sysselsättningen och den ekonomiska och sociala sammanhållningen i unionens kustregioner och yttersta randområden, och att bevara de marina ekosystemen genom att utveckla ett ekonomiskt och miljömässigt hållbart fiske.

1.  Europaparlamentet insisterar på att unionens budget för 2019 bör ha en lämplig nivå av åtagandebemyndiganden och betalningsbemyndiganden för att täcka den gemensamma fiskeripolitikens finansieringsbehov. Parlamentet anser att det behövs en adekvat nivå av tillgängliga anslag för att säkra långsiktiga investeringar, i syfte att till fullo genomföra den gemensamma fiskeripolitiken och säkerställa att EU:s vattenbruk och fiskeriverksamhet bedrivs på ett hållbart sätt.

2.  Europaparlamentet betonar att unionens fiskerisektor är starkt koncentrerad till vissa regioner som i hög grad är beroende av fisket, och att fisket, särskilt det lokala insjöfisket, bidrar till bildandet av de socioekonomiska och kulturella strukturerna i många kustområden, yttersta randområden och öregioner.

3.  Europaparlamentet konstaterar att med tanke på att mer än 60 % av de fiskeriprodukter som konsumeras i unionen kommer från internationella vatten och tredjeländers exklusiva ekonomiska zoner, måste anslagen i 2019 års budget vara tillräckligt stora, särskilt med hänsyn till avsikterna att förlänga protokollen med Mauretanien och Senegal under detta år.

4.  Europaparlamentet anser att den gemensamma fiskeripolitikens yttre dimension kräver realistiska budgetprognoser för att finansiera partnerskapsavtal om hållbart fiske med tredjeländer.

5.  Europaparlamentet betonar att genomförandenivån för EHFF 2014–2020, fyra år efter dess antagande, fortfarande är otillfredsställande, med ett aktuellt budgetgenomförande på endast 4,5% (delen för EHFF genomförs genom delad förvaltning). Parlamentet önskar att genomförandenivån för EHFF stegvis ökar, och betonar att den låga genomförandenivån delvis beror på byråkrati på nationell nivå och unionsnivå samt bristande ambitioner i medlemsstaterna, särskilt när det gäller att säkerställa ett fullständigt och snabbt genomförande av landningsskyldigheten. Parlamentet påminner om att det kommer att behövas medel för att stödja fiskesektorn i samband med genomförandet av landningsskyldigheten.

6.  Europaparlamentet betonar att tillräckliga finansiella anslag behöver avsättas till medfinansierad verksamhet, så att de segment som utgörs av kustnära fiske, småskaligt fiske och fritidsfiske kan erhålla resurser. Parlamentet anser att det dessutom är särskilt viktigt att adekvat finansiering öronmärks för uppgradering av fiskeinfrastruktur. Parlamentet anser att det är medlemsstaternas uppgift att, med utgångspunkt i den allmänna ram som tillhandahålls av EHFF, fastställa sina finansieringsprioriteringar i syfte att lösa dessa sektorers specifika problem.

7.  Europaparlamentet framhåller fiskets sociala och ekonomiska betydelse för lokalsamhällena och vissa havs- och kustregioner. Parlamentet uppmärksammar behovet av att bibehålla tillräckliga finansiella resurser för att gör det möjligt för kustflottor samt hantverksbetonade och småskaliga flottor att erhålla finansiering.

8.  Europaparlamentet betonar att vetenskapliga uppgifter är nödvändiga för att bättre förstå hur marina ekosystem fungerar, vilket är en förutsättning för ett maximalt hållbart uttag av fiskeresurser. Parlamentet påminner om att insamlingen av vetenskapliga uppgifter behöver förbättras, och att man behöver öka samarbetet och utbytet av vetenskapliga uppgifter mellan havs- och fiskerisektorn, å ena sidan, och forskarsamhället, å andra sidan. Parlamentet påminner om behovet att samla in vetenskapliga uppgifter om fritidsfiskets inverkan på fiskbestånden.

9.  Europaparlamentet upprepar vikten av att utnyttja sunda och oberoende vetenskapliga utlåtanden för att bedöma fiskeresursernas tillstånd, så att man kan fatta förvaltningsbeslut som gör det möjligt att uppnå en maximal hållbar avkastning. Parlamentet uppmanar medlemsstaterna att använda medel från EHFF för insamling av vetenskapliga uppgifter, vilket är en avgörande uppgift för att rationella och vetenskapligt baserade beslut ska kunna fattas i fiskeripolitiska frågor.

10.  Europaparlamentet understryker vikten av fiskerikontroller, eftersom dessa utgör en av de centrala delarna i den gemensamma fiskeripolitiken. Parlamentet anser att de även fortsättningsvis bör erhålla finansiering från unionen och att medlemsstaterna bör intensifiera sina ansträngningar för att utnyttja dessa medel.

11.  Europaparlamentet betonar vikten av att upprätthålla samma nivå som hittills på finansieringen till Europeiska fiskerikontrollbyrån, för att säkerställa att den på ett tillfredsställande sätt kan utföra sina inspektions- och övervakningsuppgifter inom fiskerisektorn. Parlamentet kräver en förstärkning av byråns roll, så att målen för den gemensamma fiskeripolitiken kan uppnås och så att byrån kan konsolidera sin verksamhet när det gäller förvaltningen av fiskeflottorna och övervakningen av uppföljningsförfarandena.

12.  Europaparlamentet konstaterar att en av utmaningarna inom fiskerisektorn är generationsskiftet, och att detta först och främst måste garanteras genom särskilda politiska åtgärder och ekonomiskt stöd för att uppmuntra unga att arbeta inom sektorn och erbjuda dem liknande förhållanden som inom andra ekonomiska sektorer, i synnerhet i de yttersta randområdena.

13.  Parlamentet betonar behovet av att utnyttja EHFF och andra stödsystem inom unionen för att underlätta ungdomars tillgång till yrken inom fiskenäringen.

14.  Europaparlamentet anser att Brexit inte får användas som en förevändning för att minska finansieringen. Parlamentet anser att unionen måste få fram de nödvändiga resurserna för att finansiera ett starkt ekonomiskt stöd till den gemensamma fiskeripolitiken.

INFORMATION OM ANTAGANDET I DET RÅDGIVANDE UTSKOTTET

Antagande

29.8.2018

 

 

 

Slutomröstning: resultat

+:

–:

0:

16

1

3

Slutomröstning: närvarande ledamöter

Clara Eugenia Aguilera García, Renata Briano, Alain Cadec, Richard Corbett, João Ferreira, Mike Hookem, Ian Hudghton, Carlos Iturgaiz, Werner Kuhn, António Marinho e Pinto, Gabriel Mato, Annie Schreijer-Pierik, Remo Sernagiotto, Ricardo Serrão Santos, Isabelle Thomas, Peter van Dalen, Jarosław Wałęsa

Slutomröstning: närvarande suppleanter

Ole Christensen, Rosa D’Amato, Seán Kelly, Francisco José Millán Mon, Nosheena Mobarik

SLUTOMRÖSTNING MED NAMNUPPROP I DET RÅDGIVANDE UTSKOTTET

16

+

ALDE

António Marinho e Pinto

GUE

João Ferreira

PPE

Alain Cadec, Carlos Iturgaiz, Seán Kelly, Werner Kuhn, Gabriel Mato, Annie Schreijer‑Pierik, Jarosław Wałęsa

S&D

Clara Eugenia Aguilera García, Renata Briano, Ole Christensen, Richard Corbett, Ricardo Serrão Santos, Isabelle Thomas

VERTS/ALE

Ian Hudghton

1

-

EFDD

Mike Hookem

3

0

ECR

Nosheena Mobarik, Remo Sernagiotto, Peter van Dalen

Teckenförklaring:

+  :  Ja-röster

-  :  Nej-röster

0  :  Nedlagda röster


YTTRANDE från utskottet för kultur och utbildning (4.9.2018)

till budgetutskottet

över förslaget till Europeiska unionens allmänna budget för budgetåret 2019

(2018/2046(BUD))

Föredragande av yttrande: Morten Løkkegaard

FÖRSLAG

Utskottet för kultur och utbildning uppmanar budgetutskottet att som ansvarigt utskott infoga följande förslag i det förslag till resolution som antas:

1.  Europaparlamentet påminner om att Erasmus+ fortfarande är ett mycket uppskattat och populärt program som främjar rörlighet för unga i utbildningssyfte, vilket kan ses på antalet mottagna ansökningar, som överskrider den tillgängliga finansieringen. Parlamentet beklagar djupt att anslagen i budgetförslaget för 2019 för Erasmus+ ligger långt under det som parlamentet förväntade sig och överstiger inte de planerade beloppen i den nuvarande fleråriga budgetramen, även vad gäller tillhandahållandet av den återstående tillgängliga kompletterande finansieringen för programmet enligt vad som överenskommits vid revideringen av den fleråriga budgetramen. Parlamentet begär därför att anslagen i budgetförslaget för 2019 ökas med 20 % för alla fyra budgetposter för Erasmus+, för att tillgodose de nuvarande behoven samt för att tillmötesgå medborgarnas förväntningar på programmet och de europeiska ungdomarnas förväntningar på EU när det gäller framtiden. Parlamentet upprepar i detta sammanhang att det stöder en tredubbling av anslagen till Erasmus+ i nästa fleråriga budgetram och avser att kämpa för denna ökning.

2.  Europaparlamentet upprepar sin oro över det sätt på vilket den europeiska solidaritetskåren ursprungligen inrättades utan rättslig grund och utan en fristående budgetpost. Parlamentet är dessutom obekvämt med att det slutliga beslutet om finansieringskällor för kåren – med undantag för bestämmelsen om Erasmus+ – har överlåtits åt det årliga budgetförfarandet. Parlamentet bekräftar att det noggrant kommer att granska ändringsskrivelsen från kommissionen för att säkerställa att trepartsöverenskommelsen respekteras fullt ut.

3.  Europaparlamentet betonar Kreativa Europas värde när det gäller att stödja EU:s audiovisuella och kulturella sektorer och insisterar på att finansieringsnivåerna bör motsvara programmets ambitioner. När det gäller delprogrammet Media noterar parlamentet att budgeten skulle behöva ökas med cirka 44 % för att finansiera alla projekt av hög kvalitet. Parlamentet uppmanar därför till en betydande ökning på 22 % av budgetförslaget för 2019 för att hantera den låga andelen beviljade ansökningar, för att stärka stödet till det europeiska nätverket av biografägare och för att införliva – och finansiera – den framgångsrika förberedande åtgärden om textning av kulturellt innehåll utan att äventyra finansieringen av kärnverksamheten. Parlamentet upprepar att både delprogrammet Kultur och det sektorsövergripande programområdet fortfarande är kroniskt underfinansierade och begär att anslagen ökas med minst 10 % i förhållande till 2019 års budgetförslag för båda budgetposterna. När det gäller delprogrammet Kultur föreslår parlamentet en ytterligare finansiering på 3 miljoner EUR i förhållande till budgetförslaget för 2019, utöver ökningen på 10 %, för att öka den redan framgångsrika, men för närvarande begränsade, försöksåtgärden för den enskilda rörligheten för konstnärer och kulturarbetare som förberedelse inför nästa Kreativa Europa-program.

4.  Europaparlamentet noterar med tillfredsställelse att det nya förslaget till Kreativa Europa-program stöder mediemångfald, mediefrihet och mediekompetens inom ramen för det sektorsövergripande programområdet. Parlamentet begär under tiden att budgetposten för digitalt innehåll och audiovisuella och andra medier (09 02 05) förstärks för att öka ansträngningarna för att hantera falska nyheter genom utökade åtgärder till förmån för mediekompetens och ge direkt stöd till organisationer som övervakar och främjar mediernas frihet och mångfald.

5.  Europaparlamentet välkomnar att stöd till musiksektorn ingår i det nya programmet Kreativa Europa. Parlamentet konstaterar att detta bygger på det framgångsrika pilotinitiativet inom kommissionen och den förberedande åtgärden ”Music Moves Europe”, som föreslagits av utskottet.

6.  Europaparlamentet uppmanar kommissionen att genomföra en fullständig översyn – vilken bör vidarebefordras till parlamentet – av samtliga verksamheter under budgetposten för multimedieåtgärder, för att säkerställa att dessa åtgärder ger resultat ifråga om de huvudsakliga målen. Parlamentet efterlyser ytterligare 4,2 miljoner EUR i åtagandebemyndiganden under 2019 för att trygga den viktiga verksamheten inom Euranet Plus under den återstående delen av den fleråriga budgetramen. Parlamentet påminner om att nätverkets nuvarande sätt att fungera kortsiktigt ”ur hand i mun ” inte är hållbart, och kräver en långsiktig lösning. Parlamentet konstaterar att finansieringsmålet för Euranet Plus från och med 2020 är 8,4 miljoner EUR per år.

7.  Europaparlamentet betonar vikten av programmet Ett Europa för medborgarna när det gäller att förbättra medborgarnas förståelse av EU och främja en känsla av medborgarskap. Parlamentet insisterar på att de planerade nedskärningarna inom programmet för att finansiera det omarbetade europeiska medborgarinitiativet ska återställas. Parlamentet beklagar att lagstiftningsförslaget för det nya europeiska medborgarinitiativet inte innehåller detaljerade uppgifter om budgetkonsekvenserna för programmet Ett Europa för medborgarna, vilket innebär att lagstiftaren inte har fått viktig information. Utöver återställandet av dessa medel i budgetposten begär parlamentet en anslagsökning på 10 % i budgetförslaget för 2019 – baserad på programplaneringsbeloppen i den nuvarande fleråriga budgetramen – för att tillhandahålla den minsta nödvändiga ökningen för ett program som präglas av konstant underfinansiering och en låg andel beviljade projektansökningar, vilket leder till frustration för de sökande.

8.  Europaparlamentet påminner om att Förenade kungarikets utträde ur Europeiska unionen innebär särskilt akuta utmaningar för Europaskolorna, särskilt med tanke på storleken på den engelska språksektionen (cirka 21% av alla elever) och engelskans dominerande ställning som andra språk (61 % av alla elever under skolåret 2016–2017). Parlamentet anser att viktiga budget- och utbildningsfrågor ännu måste lösas så att man på lång sikt ska kunna tillhandahålla förstklassig engelskundervisning och se till att den europeiska studentexamen även i fortsättningen erkänns i Förenade kungariket, utan att detta påverkar bestämmelserna i artikel 120 i förslaget till avtal om utträde. Parlamentet uppmanar kommissionen och styrelsen att underrätta utskottet för kultur och utbildning om sina långsiktiga planer för att hantera utmaningarna i samband med brexit.

9.  Europaparlamentet påminner om att kultur- och utbildningsrelaterade projekt får stöd genom en rad unionsprogram och instrument, bland annat ESI-fonderna, Efsi och Horisont 2020. Parlamentet uppmanar kommissionen att förbättra programöverskridande synergier för att säkerställa ett effektivt utnyttjande av medlen. Parlamentet uppmanar särskilt kommissionen att fullt ut utnyttja de potentiella synergierna mellan olika EU-program – t.ex. Horisont 2020, fonden för ett sammanlänkat Europa, Erasmus+, EaSI, Kreativa Europa och Cosme, Efsi och ESI-fonderna – för att stödja fler projekt inom de kulturella och kreativa sektorerna.

10.  Europaparlamentet betonar den potential som pilotprojekt och förberedande åtgärder har som verktyg för att testa åtgärder inom unionens politikområden och för att ta fram nya innovativa initiativ som skulle kunna omvandlas till långsiktiga EU-åtgärder. Parlamentet betonar att flera pilotprojekt och förberedande åtgärder som utskottet föreslagit under nuvarande valperiod har visat sig vara mycket framgångsrika och har banat väg för utformningen av den nya generationens utbildnings- och kulturprogram. Parlamentet beklagar att kommissionens förhandsbedömning av pilotprojekt och förberedande åtgärder ger de utskott i parlamentet som avger yttranden en mycket begränsad tid för att behandla utlåtandena och kommentarerna. Parlamentet beklagar dessutom att de utlåtanden och kommentarer som lämnats av kommissionen i vissa fall inte är helt objektiva och verkar ha påverkats av institutionella eller personliga preferenser. Parlamentet erinrar om att ett misslyckande med att genomföra ett pilotprojekt eller en förberedande åtgärd inom kommissionen aldrig kan vara ett skäl till ett dåligt utlåtande.

11.  Europaparlamentet uppmanar budgetutskottet att se över förfarandet för att hantera och fatta beslut om pilotprojekt och förberedande åtgärder, som för närvarande saknar insyn och inte ger tillräckligt utrymme för enskilda utskott som avger yttranden att utforma de politiska prioriteringarna för pilotprojekt och förberedande åtgärder inom deras respektive ansvarsområden. Parlamentet ber budgetutskottet att mer aktivt samarbeta med de enskilda utskott som avger yttranden före omröstningen i utskottet om paketet om pilotprojekt och förberedande åtgärder, och att överväga hur det skulle kunna ge de utskott som avger yttranden större befogenheter – eventuellt genom en icke bindande finansieringsram för varje utskott, bland annat grundad på parlamentets prioriteringar och tidigare utgifter inom det relevanta politikområdet – att anta egna prioriterade pilotprojekt och förberedande åtgärder. Parlamentet anser att ett sådant tillvägagångssätt skulle kunna bidra till att bemöta kommissionens kritik när det gäller det allt större antalet förslag till pilotprojekt och förberedande åtgärder under de senaste åren genom att främja en mer fokuserad och prioriteringsbaserad metod i utskotten.

INFORMATION OM ANTAGANDET I DET RÅDGIVANDE UTSKOTTET

Antagande

3.9.2018

 

 

 

Slutomröstning: resultat

+:

–:

0:

17

5

0

Slutomröstning: närvarande ledamöter

Dominique Bilde, Andrea Bocskor, Silvia Costa, Giorgos Grammatikakis, Svetoslav Hristov Malinov, Stefano Maullu, Morten Messerschmidt, Luigi Morgano, Momchil Nekov, Michaela Šojdrová, Julie Ward, Bogdan Brunon Wenta, Bogdan Andrzej Zdrojewski, Milan Zver, Krystyna Łybacka

Slutomröstning: närvarande suppleanter

Norbert Erdős, Dietmar Köster, Morten Løkkegaard, Emma McClarkin, Michel Reimon, Remo Sernagiotto

Slutomröstning: närvarande suppleanter (art. 200.2)

Mark Demesmaeker

SLUTOMRÖSTNING MED NAMNUPPROPI DET RÅDGIVANDE UTSKOTTET

17

+

ALDE

Morten Løkkegaard

PPE

Andrea Bocskor, Norbert Erdős, Svetoslav Hristov Malinov, Stefano Maullu, Michaela Šojdrová, Bogdan Brunon Wenta, Bogdan Andrzej Zdrojewski, Milan Zver

S&D

Silvia Costa, Giorgos Grammatikakis, Dietmar Köster, Krystyna Łybacka, Luigi Morgano, Momchil Nekov, Julie Ward

VERTS/ALE

Michel Reimon

5

-

ECR

Mark Demesmaeker, Emma McClarkin, Morten Messerschmidt, Remo Sernagiotto

ENF

Dominique Bilde

-

0

 

 

Teckenförklaring:

+  :  Ja-röster

-  :  Nej-röster

0  :  Nedlagda röster


YTTRANDE från utskottet för medborgerliga fri- och rättigheter samt rättsliga och inrikes frågor (4.9.2018)

till budgetutskottet

över förslaget till Europeiska unionens allmänna budget för budgetåret 2019

(2018/2046(BUD))

Föredragande av yttrande: Kostas Chrysogonos

FÖRSLAG

Utskottet för medborgerliga fri- och rättigheter samt rättsliga och inrikes frågor uppmanar budgetutskottet att som ansvarigt utskott infoga följande i sitt resolutionsförslag:

1.  Europaparlamentet välkomnar ökningen (+6,7 % jämfört med 2018) av åtagandebemyndigandena för rubrik 3 (säkerhet och medborgarskap) från 3,49 miljarder euro 2018 till 3,73 miljarder euro 2019. Parlamentet framhåller att denna ökning kräver ett tillägg avseende taket för rubrik 3 med mer än 25 % för att komplettera det med 927,5 miljoner euro 2019 (+10 % jämfört med 2018). Parlamentet konstaterar att detta är det femte året i rad som flexibilitetsmekanismen har åberopats för att stödja åtgärder som håller på att genomföras sedan 2015. Parlamentet uppmanar därför kommissionen att, som en del den nya fleråriga budgetramen efter 2020, inrätta en permanent och hållbar mekanism för att finansiera migrations- och säkerhetsåtgärder och att endast förlita sig på flexibilitetsmekanismer för att finansiera verkligt oförutsedda kriser.

2.  Europaparlamentet betonar att åtgärder för att ta itu med den inre säkerheten måste fortsätta att vara en av unionens viktigaste prioriteringar, och betonar den roll som fonden för inre säkerhet (ISF) har som ett centralt finansieringsinstrument för att stödja medlemsstaterna på säkerhetsområdet, inbegripet kampen mot terrorism och radikalisering, allvarlig och organiserad brottslighet och cyberbrottslighet. Parlamentet noterar dock ombalanseringen av åtagandebemyndigandena mellan fonden för inre säkerhet och asyl-, migrations- och integrationsfonden (Amif) till förmån för den senare till följd av resultatet av halvtidsöversynen av de båda fonderna. Parlamentet välkomnar den mycket väsentliga ökningen av åtagandebemyndigandena för Amif med 401,7 miljoner euro (+56 % jämfört med 2018) för att finansiera den nya Dublinlagstiftningen (under förutsättning att den antas senast i slutet av 2018). Parlamentet uppmanar i detta sammanhang kommissionen att under alla omständigheter prioritera omfördelningar under 2019, och välkomnar också anslaget på 175 miljoner euro, som begärts för Grekland till följd framför allt av att instrumentet för humanitära nödåtgärder upphör den 1 januari 2019.

3.  Europaparlamentet uppmanar kommissionen att öka antalet budgetposter inom Amif, i syfte att främja ökad begriplighet och transparens om hur de medel som tilldelas de olika målen och därmed dessa budgetposter kommer att användas. Parlamentet uppmanar särskilt kommissionen att hålla utgifterna för en rättvis återvändandepolitik åtskilda från utgifterna för laglig migration och främjande av en effektiv integrering av tredjelandsmedborgare i alla framtida budgetförslag. Parlamentet anser att när det gäller Amif bör projekt som stöder asylsökande och integrationen av migranter och flyktingar prioriteras. Parlamentet framhåller i detta avseende de positiva bidragen från lokala och regionala myndigheter samt det civila samhällets organisationer. Parlamentet betonar särskilt den viktiga roll som det civila samhällets organisationer spelar för att rädda livet på migranter och asylsökande vid de yttre gränserna samt för att skydda, främja och genomdriva deras rättigheter. Parlamentet ber därför unionen och medlemsstaterna att stödja det civila samhället liksom de insatser som görs av det civila samhällets organisationer, bland annat genom att bevilja dem direkt tillgång till Amif.

4.  Europaparlamentet välkomnar upprättandet av en budget på 4,9 miljoner euro för Europeiska åklagarmyndigheten, som kommer att lagföra gränsöverskridande brottslighet mot unionens ekonomiska intressen (PIF-brott). Parlamentet beklagar den kontraproduktiva minskningen av åtagandebemyndigandena för programmet Straffrätt med 2,5 miljoner euro (–5,4 % jämfört med 2018). Parlamentet är oroat över att en sådan minskning är ohållbar med tanke på den operativa tillväxten och de politiska prioriteringarna inom säkerhet och rättvisa, inbegripet terrorism och gränsöverskridanden brottslighet.

5.  Europaparlamentet beklagar den föreslagna minskningen av budgeten och tjänsteförteckningen för Eurojust, till skillnad från andra byråer på området rättsliga och inrikes frågor (RIF-byråer), vilket innebär att unionen efter halva vägen stoppar sina insatser för att bekämpa de nuvarande säkerhetshoten, eftersom det inte är möjligt att göra en effektiv rättslig uppföljning. Parlamentet noterar att Eurojust är det enda unionsorgan som kan garantera detta genom samordning och samarbete mellan de utredande myndigheterna i kampen mot terrorism, cyberbrottslighet, smuggling av migranter och organiserad brottslighet. Parlamentet betonar att tillhandahållandet av tillräckliga ekonomiska medel till Eurojust är en nödvändig förutsättning för att Eurojust ska kunna fungera väl och för att all dess strategiska och operativa verksamhet ska kunna utvecklas, så att den ska kunna hantera sin allt större arbetsbörda och samordnande verksamhet samt undvika negativa effekter för verksamheten. Parlamentet begär därför enträget att Eurojust stärks med en budget för 2019 på 41,2 miljoner euro och med totalt 217 tjänster. Parlamentet betonar behovet av att anpassa Eurojusts budgetbehov till en realistisk prognos i den fleråriga budgetramen efter 2020 i linje med parlamentets ståndpunkt om behovet av att tillhandahålla tillräckliga resurser i den fleråriga budgetramen efter 2020 till RIF-byråerna för att undvika en systematisk användning av flexibilitetsbestämmelserna i den fleråriga budgetramen varje år.

6.  Europaparlamentet välkomnar att den föreslagna finansieringsnivån för Europeiska stödkontoret för asylfrågor motsvarar kontorets ursprungliga begäran gentemot kommissionen. Parlamentet förväntar sig att kommissionen lägger fram en ändringsbudget för att öka anslagen för insatser om nivån på det operativa stöd som medlemsstaterna begär ökar för 2019.

7.  Europaparlamentet framhåller att 2019 kommer att bli ett utmanande år för Europeiska byrån för den operativa förvaltningen av stora it-system inom området frihet, säkerhet och rättvisa (eu-LISA) med tanke på den betydande ökningen av byråns arbetsuppgifter och tilldelade budget och att byrån kommer att behöva en tillräcklig förstärkning av sina resurser för att kunna uppvisa resultat i enlighet med sitt nya uppdrag. Parlamentet är därför bekymrat över den föreslagna otillräckliga finansieringen samt bemanningen av eu-LISA med tanke på den ökande komplexiteten i dess uppgifter, inbegripet uppdateringen av befintliga databaser (Schengens informationssystem (SIS), Eurodac och informationssystemet för viseringar) samt genomförande och operativ förvaltning av andra storskaliga it-system inom området rättsliga och inrikes frågor. Parlamentet betonar att åtagandebemyndiganden är nödvändiga för eu-LISA, särskilt för att genomföra den planerade verksamheten under 2019, inbegripet den andra fasen av det automatiska fingeravtrycksidentifieringssystemet (Afis) och SIS. Parlamentet betonar att det är nödvändigt att förstärka eu-LISA:s resurser och bevilja ytterligare 25 kontraktsanställda som ska göra det möjligt för byrån att uppvisa resultat i enlighet med dess uppdrag.

8.  Europaparlamentet välkomnar anslagsökningen (+16 % jämfört med 2018) för Europeiska datatillsynsmannens administrativa utgifter för att täcka dess nya ansvar som sekretariat för Europeiska dataskyddsstyrelsen och dess ytterligare behov med anknytning till de nya dataskyddsreglerna vid unionens institutioner, samt för att övervaka och säkerställa efterlevnaden av dataskyddsreglerna hos de organ som tidigare omfattades av den tredje pelaren.

9.  Europaparlamentet begär en ökning av de AD-tjänster som inrättas för Europeiska gräns- och kustbevakningsbyråns ombud för grundläggande rättigheter (Frontex) för att hjälpa byrån att få expertis på hög nivå om de grundläggande rättigheterna och hantera de ytterligare uppgifter som ombudet för grundläggande rättigheter har.

10.  Europaparlamentet beklagar att budgeten för Europeiska unionens byrå för grundläggande rättigheter (FRA) inte utökats då byrån förväntas få nya arbetsuppgifter och ansvarsområden under 2019 med tanke på att de grundläggande rättigheterna fortfarande är under tryck. Parlamentet betonar att de ytterligare uppgifter som tilldelats FRA har ökat avsevärt sedan 2015 på grund av att det har anlänt ett ökat antal flyktingar, migranter och asylsökande. Parlamentet är oroat över att byråns mandat ännu begränsar dess roll för att stödja grundläggande rättigheter. Parlamentet betonar att byrån bör ha möjlighet att på eget initiativ avge yttranden över lagstiftningsförslag och att dess ansvarsområde bör utökas till att omfatta alla typer av rättigheter som skyddas enligt Europeiska unionens stadga för grundläggande rättigheter, t.ex. frågor rörande polissamarbete och rättsligt samarbete. Parlamentet föreslår därför att man utvidgar byråns ekonomiska resurser och personalresurser ordentligt så att byrån på ett adekvat sätt kan utföra sina nya uppgifter till följd av önskemål från unionsinstitutionerna, medlemsstaterna och andra unionsbyråer. Parlamentet upprepar att kommissionen bör fortsätta att fokusera på frågor som rör rättsstaten och grundläggande rättigheter, särskilt med tanke på den demokratiska tillbakagången i vissa medlemsstater, bland annat genom att föreslå striktare mekanismer för övervakning och prövning.

11.  Europaparlamentet påpekar att det behövs fler mänskliga och ekonomiska resurser för att Europeiska unionens byrå för utbildning av tjänstemän inom brottsbekämpning (Cepol) fullt ut ska kunna genomföra sin nya rättsliga grund från 2015, som breddade den målgrupp som den riktar sig till från högre polistjänstemän till tjänstemän inom brottsbekämpning i unionen och dess grannskap. Parlamentet anser att detta kommer att bidra till att överbrygga det utbildningsgap som hindrar medlemsstaternas brottsbekämpande myndigheter från att till fullo utnyttja instrument och system för samarbete på unionsnivå när det gäller organiserad brottslighet och terrorism, samtidigt som de grundläggande rättigheterna tas upp som en övergripande fråga när det gäller utbildning i brottsbekämpning.

12.  Europaparlamentet framhåller den mycket väsentliga ökningen från 10 miljarder euro 2018 till 11,38 miljarder euro 2019 (+13,1 %) i åtagandebemyndiganden och betalningsbemyndiganden (+17,0 %) för rubrik 4 (Europa i världen). Parlamentet välkomnar förslaget om att använda den icke-fördelade marginalen inom ramen för rubrik 4 fullt ut under 2019, liksom 1 116,2 miljoner euro från den samlade marginalen för åtaganden i syfte att stärka det humanitära biståndet och europeiska grannskapsinstrumentet vad gäller de utfästelser som gjordes vid Syrienkonferensen 2018. Parlamentet konstaterar att 1,45 miljarder euro av unionens budget har budgeterats för att finansiera den andra faciliteten för flyktingar i Turkiet och att 560 miljoner euro har budgeterats för att ta itu med krisen i Syrien. Parlamentet betonar den mycket kraftiga ökningen av unionens bidrag från dess budget till den andra faciliteten för flyktingar i Turkiet. Parlamentet uppmanar kommissionen att effektivt övervaka en korrekt tilldelning och ett korrekt genomförande av detta bidrag med tanke på den pågående försämringen i fråga om de grundläggande fri- och rättigheterna samt rättsstaten och rättsväsendets bristande oberoende i Turkiet.

13.  Europaparlamentet välkomnar kommissionens förslag om en översyn av unionens civilskyddsmekanism, i syfte att stärka den övergripande strategin för katastrofhantering. Parlamentet betonar att de ökade åtagandebemyndigandena (+46,1 %) och betalningsbemyndigandena (+33,6 %) för civilskyddsmekanismen 2019 jämfört med 2018 återspeglar den förväntade användningen för åtgärder i tredjeländer. Parlamentet ser positivt på att 2019 års tilldelning av humanitärt bistånd innebär ökningar på 120 miljoner euro när det gäller budgetplaneringen och 3,2 miljoner euro för att öka åtgärderna för katastrofberedskap.

14.  Europaparlamentet uppmanar kommissionen att stärka stödet till undersökande journalistik, inbegripet gränsöverskridande undersökande journalistik, och mediefrihet, genom att avsätta särskilda medel som en åtgärd för att bekämpa brottslighet och öka medvetenheten bland unionens medborgare.

INFORMATION OM ANTAGANDET I DET RÅDGIVANDE UTSKOTTET

Antagande

30.8.2018

 

 

 

Slutomröstning: resultat

+:

–:

0:

35

8

0

Slutomröstning: närvarande ledamöter

Asim Ademov, Heinz K. Becker, Monika Beňová, Daniel Dalton, Rachida Dati, Frank Engel, Tanja Fajon, Romeo Franz, Nathalie Griesbeck, Sylvie Guillaume, Monika Hohlmeier, Brice Hortefeux, Sophia in ‘t Veld, Barbara Kudrycka, Cécile Kashetu Kyenge, Claude Moraes, Ivari Padar, Judith Sargentini, Birgit Sippel, Branislav Škripek, Helga Stevens, Traian Ungureanu, Marie-Christine Vergiat, Udo Voigt, Josef Weidenholzer, Kristina Winberg, Auke Zijlstra

Slutomröstning: närvarande suppleanter

Carlos Coelho, Gérard Deprez, Anna Hedh, Teresa Jiménez-Becerril Barrio, Jean Lambert, Andrejs Mamikins, Ana Miranda, Angelika Mlinar, Maite Pagazaurtundúa Ruiz, Christine Revault d’Allonnes Bonnefoy, Barbara Spinelli, Axel Voss

Slutomröstning: närvarande suppleanter (art. 200.2)

Jonathan Bullock, Kostadinka Kuneva, Luigi Morgano, Gabriele Preuß

SLUTOMRÖSTNING MED NAMNUPPROPI DET RÅDGIVANDE UTSKOTTET

35

+

ALDE

Gérard Deprez, Nathalie Griesbeck, Sophia in 't Veld, Angelika Mlinar, Maite Pagazaurtundúa Ruiz

GUE/NGL

Kostadinka Kuneva, Barbara Spinelli, Marie-Christine Vergiat

PPE

Asim Ademov, Heinz K. Becker, Carlos Coelho, Rachida Dati, Monika Hohlmeier, Brice Hortefeux, Teresa Jiménez-Becerril Barrio, Barbara Kudrycka, Traian Ungureanu, Axel Voss

S&D

Monika Beňová, Tanja Fajon, Sylvie Guillaume, Anna Hedh, Cécile Kashetu Kyenge, Andrejs Mamikins, Claude Moraes, Luigi Morgano, Ivari Padar, Gabriele Preuß, Christine Revault d'Allonnes Bonnefoy, Birgit Sippel, Josef Weidenholzer

VERTS/ALE

Romeo Franz, Jean Lambert, Ana Miranda, Judith Sargentini

8

-

ECR

Daniel Dalton, Branislav Škripek, Helga Stevens, Kristina Winberg

EFDD

Jonathan Bullock

ENF

Auke Zijlstra

NI

Udo Voigt

PPE

Frank Engel

0

0

 

 

Teckenförklaring:

+  :  Ja-röster

-  :  Nej-röster

0  :  Nedlagda röster


YTTRANDE från utskottet för konstitutionella frågor (4.7.2018)

till budgetutskottet

över förslaget till Europeiska unionens allmänna budget för budgetåret 2019

(2018/2046(BUD))

Föredragande av yttrande: Danuta Maria Hübner

FÖRSLAG

Utskottet för konstitutionella frågor uppmanar budgetutskottet att som ansvarigt utskott infoga följande förslag i det förslag till resolution som antas:

A.  2019 kommer att vara året för valet till Europaparlamentet och för Förenade kungarikets utträde ur unionen.

1.  Europaparlamentet välkomnar den föreslagna ökningen på 4,1 % av åtagandebemyndigandena och 2,1 % av betalningsbemyndigandena för programmet Ett Europa för medborgarna, och ökningen på 3,7 % av åtagandebemyndigandena och 24,4 % av betalningsbemyndigandena för programmet Rättigheter, jämlikhet och medborgarskap, jämfört med 2018 års budget, eftersom dessa program bidrar till att öka medborgarnas deltagande i unionens politik överlag och utövande av de rättigheter som följer av unionsmedborgarskapet.

2.  Europaparlamentet anser att en förstärkning av unionens institutioner är nödvändig ur konstitutionell synvinkel och att de gränsöverskridande utmaningar som måste hanteras, t.ex. klimatförändringar och invandring, kräver en budget för 2019 som är högre i reala termer än budgeten för 2018.

3.  Europaparlamentet efterlyser en anslagsökning med 10 % till programmet Ett Europa för medborgarna på grundval av resultaten av halvtidsutvärderingen av genomförandet av programmet(1), där det nämns att många projekt, som kunde ha ökat programmets genomslagskraft, inte kunde finansieras.

4.  Europaparlamentet anser att ytterligare budgetanslag bör avsättas för att stärka kunskaperna om EU i synnerhet, men inte uteslutande, genom att medel avsätts för att finansiera utvecklingen av en modell för ett gemensamt program för utbildning om medborgarskapet.

5.  Europaparlamentet välkomnar ökningen på 46 % av åtagandebemyndigandena för det europeiska medborgarinitiativet och beklagar minskningen på 3 % av betalningsbemyndigandena för detta program jämfört med 2018 års nivåer.

6.  Europaparlamentet välkomnar den ökade finansieringen till europeiska politiska partier med 35 % i åtagandebemyndiganden och betalningsbemyndiganden i linje med de ändringar som nyligen gjorts genom Europaparlamentets och rådets förordning (EU, Euratom) 2018/673(2) om stadgar för och finansiering av europeiska politiska partier och europeiska politiska stiftelser.

7.  Europaparlamentet noterar att anslagen till kommunikationsåtgärder ökats med 5,3 % i åtagandebemyndiganden och 2,3 % i betalningsbemyndiganden och beklagar att ökningen inte är större, särskilt med tanke på att 2019 är året för valet till Europaparlamentet.

8.  Europaparlamentet anser att europeiska allmänna platser har outnyttjad potential att förse medborgarna med information om de frågor som står på spel i valet till Europaparlamentet och deras deltagande i debatten om Europas framtid. Parlamentet anser därför att nätverket med europeiska allmänna platser bör utvidgas till att omfatta alla medlemsstater. Parlamentet beklagar att detta mål inte kunde nås för 2019 års val till Europaparlamentet, eftersom det bara finns 18 europeiska allmänna platser, trots att det enligt budgetplaneringen borde ha funnits 21 senast 2019.

9.   Europaparlamentet anser att budgeten för 2019 bör tillhandahålla ytterligare finansiering för program för att stödja och integrera invandrare och flyktingar, särskilt i unionens gränsstater, också i syfte att garantera deras fulla integrering i den rättsgemenskap som Europeiska unionen utgör.

10.  Europaparlamentet beklagar att kommissionen fortlöpande använder medel från befintliga budgetposter för att finansiera nya fonder som ligger utanför EU:s budget och därför inte omfattas av den parlamentariska granskningen.

INFORMATION OM ANTAGANDET I DET RÅDGIVANDE UTSKOTTET

Antagande

2.7.2018

 

 

 

Slutomröstning: resultat

+:

–:

0:

21

3

0

Slutomröstning: närvarande ledamöter

Gerolf Annemans, Mercedes Bresso, Elmar Brok, Richard Corbett, Pascal Durand, Esteban González Pons, Danuta Maria Hübner, Ramón Jáuregui Atondo, Alain Lamassoure, Jo Leinen, Maite Pagazaurtundúa Ruiz, Markus Pieper, Paulo Rangel, Helmut Scholz, György Schöpflin, Pedro Silva Pereira, Barbara Spinelli, Josep-Maria Terricabras, Kazimierz Michał Ujazdowski, Guy Verhofstadt

Slutomröstning: närvarande suppleanter

Ashley Fox, Jérôme Lavrilleux, David McAllister, Cristian Dan Preda

Slutomröstning: närvarande suppleanter (art. 200.2)

Daniela Aiuto, Jonás Fernández, Birgit Sippel

SLUTOMRÖSTNING MED NAMNUPPROP I DET RÅDGIVANDE UTSKOTTET

21

+

ALDE

Maite Pagazaurtundúa Ruiz, Guy Verhofstadt

GUE/NGL

Helmut Scholz, Barbara Spinelli

NI

Kazimierz Michał Ujazdowski

PPE

Elmar Brok, Esteban González Pons, Danuta Maria Hübner, Alain Lamassoure, Jérôme Lavrilleux, Markus Pieper, Paulo Rangel, György Schöpflin

S&D

Mercedes Bresso, Richard Corbett, Jonás Fernández, Jo Leinen, Pedro Silva Pereira, Birgit Sippel

VERTS/ALE

Pascal Durand, Josep Maria Terricabras

3

-

ECR

Ashley Fox

EFDD

Daniela Aiuto

ENF

Gerolf Annemans

0

0

 

 

Teckenförklaring:

+  :  Ja-röster

-  :  Nej-röster

0  :  Nedlagda röster

(1)

COM(2018)0170.

(2)

Europaparlamentets och rådets förordning (EU, Euratom) 2018/673 av den 3 maj 2018 om ändring av Europaparlamentets och rådets förordning (EU, Euratom) nr 1141/2014 om stadgar för och finansiering av europeiska politiska partier och europeiska politiska stiftelser (EUT L 114I, 4.5.2018, p. 1).


YTTRANDE från utskottet för kvinnors rättigheter och jämställdhet mellan kvinnor och män (28.9.2018)

till budgetutskottet

över förslaget till Europeiska unionens allmänna budget för budgetåret 2019

(2018/2046(BUD))

Föredragande av yttrande: Malin Björk

FÖRSLAG

Utskottet för kvinnors rättigheter och jämställdhet mellan kvinnor och män uppmanar budgetutskottet att som ansvarigt utskott infoga följande förslag i det förslag till resolution som antas:

A.  Europeiska unionen bygger bland annat på värdet av jämställdhet och enligt artikel 8 i fördraget om Europeiska unionens funktionssätt är främjandet av sådan jämställdhet en av unionens grundläggande principer, vilket innebär att jämställdhetsperspektivet måste införlivas i all EU-politik och alla EU-åtgärder och beaktas på alla nivåer av budgetförfarandet genom jämställdhetsintegrering och jämställdhetsbudgetering.

B.  Ojämlikhet är ett växande problem i unionen, något som blivit tydligt den senaste tiden genom bakslaget för kvinnors rättigheter och jämställdhet mellan kvinnor och män. Unionens budget måste i allt större utsträckning utformas så att den i väsentlig grad bidrar till att skydda och utveckla sociala rättigheter och förbättra jämställdheten och kvinnors situation.

C.  Jämställdhetsbudgetering är en tillämpning av jämställdhetsintegrering i budgetprocessen och innebär en jämställdhetsbaserad budgetbedömning som inbegriper ett jämställdhetsperspektiv på alla nivåer i budgetprocessen och en omstrukturering av intäkter och utgifter för att främja jämställdhet(1).

D.  Kvinnor tillbringar mer tid än män med obetalt omsorgsarbete, vilket är en av de främsta orsakerna till att kvinnor är underrepresenterade på arbetsmarknaden. Efterfrågan på barnomsorg och långtidsvård som är högkvalitativ, tillgänglig och överkomligt prissatt är högre än det nuvarande utbudet och vissa familjer från missgynnade miljöer har svårt att bekosta privata vårdtjänster.

E.  Europaparlamentet har vid flera tillfällen begärt tillräcklig finansiering och strävat efter att hålla högsta möjliga profil för det specifika målet Daphne inom ramen för programmet Rättigheter, jämlikhet och medborgarskap för att skydda kvinnor och flickor mot våld.

F.  Jämställdhetsanpassade budgetar och närliggande politikområden som syftar till att uppnå jämställdhet mellan kvinnor och män leder till en mer hållbar tillväxt och sysselsättning för alla och ökar transparensen i och ansvarigheten för offentliga utgifter.

G.  Ett av huvudsyftena med förslaget till Europeiska unionens allmänna budget för budgetåret 2019 är strategiska investeringar och hållbar tillväxt i syfte att främja ekonomisk sammanhållning och skapa arbetstillfällen, särskilt för ungdomar. I detta sammanhang är det viktigt att också fokusera på att öka kvinnors potential i alla sektorer av ekonomin, även i den digitaliserade ekonomin och inom informations- och kommunikationsteknik (IKT) och vetenskap, teknik, ingenjörsvetenskap och matematik (STEM). Ett särskilt fokus på jämställdhet inom dessa områden innebär att det är nödvändigt att ta itu med den betydande klyftan mellan könen och den unionsomfattande bristen på kompetens inom IKT- och STEM-sektorerna.

H.  Internationella organisationer såsom IMF förespråkar med eftertryck jämställdhetsbudgetering som ett standardverktyg för gott styre på området för offentliga finanser och anser att jämställdhetsbudgetering är god budgetering. OECD anser att jämställdhetsbudgetering är ett viktigt verktyg för att genomföra jämställdhet inom ramen för de offentliga finanserna. Europaparlamentets, rådets och kommissionens gemensamma förklaring till den fleråriga budgetramen 2014–2020 är bindande för de tre institutionerna och i denna anges att i tillämpliga fall ska jämställdhetsfrågor integreras i EU:s budget, men i kommissionens Strategiskt engagemang för jämställdhet 2016–2020 fastställs att jämställdhetsbudgetering inte tillämpas systematiskt inom ramen för EU:s allmänna budget.

I.  EU har åtagit sig att främja jämställdhet och lika möjligheter för kvinnor och män, och kvinnor och män bör därför också dra lika stor nytta av offentliga medel och tjänster, men trots EU:s politiska åtaganden på hög nivå när det gäller jämställdhet och integrering av ett jämställdhetsperspektiv, tar inte utgiftsbesluten hänsyn till jämställdhet inom alla politikområden.

J.  Unionen och dess medlemsstater är tillsammans de ledande givarna av världens utvecklingsbistånd och tillhandhåller över 50 % av detta bistånd. Det minskade stödet från andra givare på områdena sexuell och reproduktiv hälsa och rättigheter, och kvinnors reproduktiva hälsa och rättigheter kräver en ökning av unionens nuvarande finansiering, särskilt på områden med särskilda jämställdhetsaspekter.

K.  EU har i den gemensamma förklaringen om handel och kvinnors ekonomiska egenmakt åtagit sig att göra framsteg när det gäller att göra sin handels- och utvecklingspolitik mer jämställdhetsinriktad och att rapportera om detta under 2019. Parlamentet har antagit en resolution om jämställdhet i EU:s handelsavtal som uppmanar till åtskilliga nya åtgärder inom jämställdhet och handel som kräver kraftfulla budgetmässiga och politiska åtaganden.

L.  Människohandel är ett förödande brott som hotar samhällets mest utsatta, främst kvinnor och flickor, som utnyttjas för prostitution.

1.  Europaparlamentet uppmanar kommissionen och rådet att systematiskt använda jämställdhetsbudgetering för alla offentliga utgifter, inbegripet vid förhandlingar om och det praktiska fastställandet av nästa fleråriga budgetram, i syfte att vara lyhörd för jämställdhetsfrågor och uppfylla målen för hållbar utveckling genom främjande och genomförande av mål 5 om jämställdhet mellan kvinnor och män och integrering av ett jämställdhetsperspektiv i alla mål för hållbar utveckling.

2.  Europaparlamentet har åtagit sig att värna om främjandet och skyddet av jämställdhet och kvinnors och flickors rättigheter under 2019 års budgetförfarande. Parlamentet uppmanar medlemsstaterna och kommissionen att integrera jämställdhetsbudgetering i budgetförfarandet i samtliga budgetposter, och inte bara i de program där jämställdhetseffekterna är mest uppenbara, så att budgetmässiga utgifter och inkomster främjar jämställdheten och kvinnors rättigheter.

3.  Europaparlamentet är bekymrat över att jämställdhetsmålen, trots kraftfulla interinstitutionella och politiska uttalanden, inte uttryckligen anges i EU:s budgetdokument och inte heller beaktas i alla skeden av budgetprocessen, och att det under de senaste åren har blivit omöjligt att följa upp budgetåtaganden för att främja jämställdhet mellan kvinnor och män på grund av att särskilda budgetposter för jämställdhet har strukits. Parlamentet betonar att det är nödvändigt att koppla jämställdhetsmålen till särskilda budgetanslag. Parlamentet tillägger att dessa anslag bör tjäna både integrering och målinriktade åtgärder, eftersom den dubbla strategin är central för en positiv inverkan på jämställdheten. 

4.  Europaparlamentet påminner om att jämställdhetsbudgetering är en dimension i en bredare strategi för integrering av ett jämställdhetsperspektiv och påpekar vikten av att genomföra integrering av ett jämställdhetsperspektiv i alla skeden av den politiska processen. Parlamentet betonar att det finns en tydlig möjlighet att på ett lämpligt sätt genomföra integreringen av ett jämställdhetsperspektiv när ny politik och nya organ utformas.

5.  Europaparlamentet betonar att en ”modern, fokuserad EU-budget” inte kan uppnås utan ett tydligt och heltäckande genusperspektiv som är avgörande för att möjliggöra ett bättre och mer evidensbaserat beslutsfattande, vilket i sin tur bidrar till att säkerställa en effektiv användning av offentliga medel och ett europeiskt mervärde i alla EU-åtgärder.

6.  Europaparlamentet begär en helhetssyn vid utformningen av den nya europeiska arbetsmyndigheten genom att införa ett krav på att genomföra jämställdhetsbudgetering i arbetsmyndighetens förordning och en enskild budgetpost i 2019 års budget för att genomföra integreringen av ett jämställdhetsperspektiv inom ramen för europeiska arbetsmyndighetens behörighet.

7.  Europaparlamentet bekräftar på nytt sin begäran om en ökning av resurserna, bland annat genom Europeiska socialfonden, Europeiska regionala utvecklingsfonden, Europeiska jordbruksfonden för landsbygdsutveckling och EU:s sammanhållningsfond, för att upprätthålla kvinnors ekonomiska och sociala rättigheter, särskilt genom kvinnors sysselsättning och investeringar i offentliga tjänster av hög kvalitet, och minska obalansen mellan könen, bland annat genom användning av befintliga instrument på EU- och medlemsstatsnivå och inrätta en enskild budgetpost för detta ändamål.

8.  Europaparlamentet efterlyser anslag till stöd för kvinnligt företagande och för att säkerställa och främja kvinnors tillgång till lån och finansiering av eget kapital genom EU-program och EU-fonder, t.ex. Cosme, Horisont 2020 och Europeiska socialfonden.

9.  Europaparlamentet vill se att ett jämlikt deltagande av flickor och unga kvinnor säkerställs i samband med åtgärder som omfattas av ungdomssysselsättningsinitiativet och att särskild uppmärksamhet ägnas åt högkvalitativa utbildningsmöjligheter och sysselsättning för dem, även i den digitaliserade ekonomin och inom IKT- och STEM-sektorerna.

10.  Europarlamentet uppmanar medlemsstaterna att säkerställa välstrukturerade initiativ för jämställdhetsbudgetering som främjar jämställdhet genom utbildning och hälso- och sjukvårdstjänster, särskilt omfattande sexualundervisning och tjänster relaterade till sexuell och reproduktiv hälsa och rättigheter.

11.  Europaparlamentet påminner om att ett av kraven för att genomföra jämställdhetsbudgetering är att planera för oberoende budgetposter för jämställdhetsmål som fastställts i ett program. Parlamentet betonar behovet av att öka resurserna för att bekämpa alla former av våld mot kvinnor och flickor samt könsrelaterat våld mot hbtqi-personer, bland annat genom att inrätta en oberoende budgetpost för Daphne och främja jämlikhet och integreringen av ett jämställdhetsperspektiv inom ramen för programmet Rättigheter, jämlikhet och medborgarskap för perioden 2014–2020 och, med avseende på förberedelsen av nästa fleråriga budgetram, behovet av att inrätta en särskild budgetpost för detta ändamål. Parlamentet vill se en hållbar och tillräcklig finansiering för åtgärder som syftar till ett effektivt genomförande av Istanbulkonventionen, med särskild uppmärksamhet på och ekonomiskt stöd till kontinuerlig fortbildning av personal inom rättsväsendet och annan personal som hanterar klagomål om sexuella trakasserier och könsrelaterat våld.

12.  Europaparlamentet uppmanar EU och medlemsstaterna att inbegripa konkreta åtgärder och anslå tillräckliga ekonomiska resurser för att bekämpa våld mot kvinnor och flickor och säkerställa skydd för migrerande kvinnor och flyktingkvinnor samt kvinnor som befinner sig i en irreguljär situation, mot våld. Parlamentet insisterar på riktade investeringar för att säkerställa kvinnors rättigheter och säkerhet i hela asylförfarandet.

13.  Europaparlamentet påminner om att ett mycket stort antal flyktingar och asylsökande som kommer till EU är kvinnor och barn. Parlamentet framhåller att integreringen av ett jämställdhetsperspektiv också är en av de grundläggande principerna för asyl-, migrations- och integrationsfonden (Amif) och upprepar sin uppmaning att beakta jämställdhetsdimensionen när det gäller migrations- och asylpolitiken genom att anslå särskilda medel för att förhindra könsrelaterat våld och säkerställa tillgång till hälso- och sjukvård och reproduktiv hälsa och rättigheter.

14.  Europaparlamentet uppmanar unionen och dess medlemsstater att intensifiera sina ansträngningar för att utrota handeln med kvinnor och flickor för sexuellt utnyttjande genom tillräckliga budgetåtaganden i hela unionen och att i större utsträckning investera i brottsoffers rättigheter och skydd samt i åtgärder som minskar efterfrågan på kvinnor och flickor som fallit offer för människohandel. 

15.  Europaparlamentet uppmanar unionen och medlemsstaterna att via EU:s utvecklingsbistånd främja organisationer för kvinnors rättigheter, flickors egenmakt och kvinnors representation i beslutsfattandet. Parlamentet påminner om det brådskande behovet av att öka unionens anslag för sexuell och reproduktiv hälsa och rättigheter, i syfte att täcka det ekonomiska underskott som uppstått efter att Förenta staterna återinfört och utvidgat sin så kallade globala munkavleregel.

16.  Europaparlamentet understryker behovet av att motverka det krympande utrymmet för civilsamhället och uppmanar unionen och medlemsstaterna att prioritera investeringar för att stödja och skydda människorättsförsvarare, särskilt kvinnliga människorättsförsvarare, som ställs inför unika, könsrelaterade hinder och hot i sitt arbete, genom att ge dem synligt politiskt stöd och erkännande, särskilt genom akuta bidrag inom ramen för nödfonden för utsatta människorättsförsvarare som finns hos det europeiska instrumentet för demokrati och mänskliga rättigheter (EIDMR).

17.  Europaparlamentet anser att i syfte att nå sina åtaganden att uppnå mål 5 för hållbar utveckling, och särskilt målet att säkerställa allmän tillgång till sexuell och reproduktiv hälsa och rättigheter, bör kommissionen införa öronmärkt finansiering för sexuell och reproduktiv hälsa och rättigheter, inbegripet familjeplanering, genom en särskild budgetpost för sexuell och reproduktiv hälsa och rättigheter eller genom att utse detta område till ett mål inom ramen för dess olika budgetposter såsom hälso- och sjukvård, utbildning, ungdomars inflytande, mänskliga rättigheter, kön.

18.  Europaparlamentet uppmanar med eftertryck unionen och medlemsstaterna att öka stödet till flickors och kvinnors sociala, ekonomiska och kulturella rättigheter i partnerländerna. Parlamentet uppmanar i detta sammanhang alla parter att se till att genomförandet av EU:s andra handlingsplan för jämställdhet förbättras på grundval av resultaten i de årliga rapporterna.

19.  Europaparlamentet påminner om den viktiga roll som Europeiska jämställdhetsinstitutet spelar och vill se att institutets budget, tjänsteförteckning och oberoende upprätthålls.

20.  Europaparlamentet uppmanar unionen att stödja utvecklingen av nya åtgärder för att främja och stödja jämställdhet mellan könen, kvinnors mänskliga rättigheter och deras ekonomiska egenmakt i unionens handelspolitik och att avsätta tillräckliga ekonomiska resurser för dessa åtaganden.

INFORMATION OM ANTAGANDET I DET RÅDGIVANDE UTSKOTTET

Antagande

27.9.2018

 

 

 

Slutomröstning: resultat

+:

–:

0:

18

3

1

Slutomröstning: närvarande ledamöter

Daniela Aiuto, Beatriz Becerra Basterrechea, Malin Björk, Vilija Blinkevičiūtė, Anna Maria Corazza Bildt, André Elissen, Iratxe García Pérez, Mary Honeyball, Angelika Mlinar, Maria Noichl, Marijana Petir, Pina Picierno, Ernest Urtasun, Jadwiga Wiśniewska, Michaela Šojdrová

Slutomröstning: närvarande suppleanter

Stefan Eck, José Inácio Faria, Kostadinka Kuneva, Jérôme Lavrilleux, Jordi Solé

Slutomröstning: närvarande suppleanter (art. 200.2)

Marek Plura, Damiano Zoffoli

SLUTOMRÖSTNING MED NAMNUPPROP I DET RÅDGIVANDE UTSKOTTET

18

+

ALDE

Beatriz Becerra Basterrechea, Angelika Mlinar

EFDD

Daniela Aiuto

GUE/NGL

Malin Björk, Stefan Eck, Kostadinka Kuneva

PPE

Anna Maria Corazza Bildt, José Inácio Faria, Jérôme Lavrilleux, Marek Plura

S&D

Vilija Blinkevičiūtė, Iratxe García Pérez, Mary Honeyball, Maria Noichl, Pina Picierno, Damiano Zoffoli

VERTS/ALE

Jordi Solé, Ernest Urtasun

3

-

ECR

Jadwiga Wiśniewska

ENF

André Elissen

PPE

Marijana Petir

1

0

PPE

Michaela Šojdrová

Teckenförklaring:

+  :  Ja-röster

-  :  Nej-röster

0  :  Nedlagda röster

(1)


INFORMATION OM ANTAGANDET I DET ANSVARIGA UTSKOTTET

Antagande

9.10.2018

 

 

 

Slutomröstning: resultat

+:

–:

0:

27

5

2

Slutomröstning: närvarande ledamöter

Nedzhmi Ali, Jean Arthuis, Richard Ashworth, Reimer Böge, Lefteris Christoforou, Gérard Deprez, Manuel dos Santos, José Manuel Fernandes, Eider Gardiazabal Rubial, Jens Geier, Ingeborg Gräßle, Iris Hoffmann, Monika Hohlmeier, John Howarth, Bernd Kölmel, Zbigniew Kuźmiuk, Vladimír Maňka, Siegfried Mureşan, Jan Olbrycht, Younous Omarjee, Răzvan Popa, Paul Rübig, Petri Sarvamaa, Jordi Solé, Patricija Šulin, Eleftherios Synadinos, Isabelle Thomas, Inese Vaidere, Monika Vana, Daniele Viotti, Tiemo Wölken

Slutomröstning: närvarande suppleanter

Andrey Novakov

Slutomröstning: närvarande suppleanter (art. 200.2)

Eleonora Evi, Auke Zijlstra


SLUTOMRÖSTNING MED NAMNUPPROP I DET ANSVARIGA UTSKOTTET

27

+

ALDE

Nedzhmi Ali, Jean Arthuis, Gérard Deprez

ECR

Zbigniew Kuźmiuk

PPE

Richard Ashworth, Reimer Böge, Lefteris Christoforou, José Manuel Fernandes, Ingeborg Gräßle, Monika Hohlmeier, Siegfried Mureşan, Andrey Novakov, Jan Olbrycht, Paul Rübig, Petri Sarvamaa, Patricija Šulin, Inese Vaidere

S&D

Eider Gardiazabal Rubial, Jens Geier, Iris Hoffmann, John Howarth, Vladimír Maňka, Răzvan Popa, Manuel dos Santos, Isabelle Thomas, Daniele Viotti, Tiemo Wölken

5

-

ECR

Bernd Kölmel

EFDD

Eleonora Evi

ENF

Auke Zijlstra

GUE/NGL

Younous Omarjee

NI

Eleftherios Synadinos

2

0

VERTS/ALE

Jordi Solé, Monika Vana

Teckenförklaring:

+  :  Ja-röster

-  :  Nej-röster

0  :  Nedlagda röster

Senaste uppdatering: 19 oktober 2018Rättsligt meddelande